SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000015282 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000015282
Domain Number 1 Region: 1095-1193
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-24
Family Pleckstrin-homology domain (PH domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000015282   Gene: ENSCAFG00000010394   Transcript: ENSCAFT00000016519
Sequence length 1204
Comment pep:known_by_projection chromosome:CanFam3.1:33:16500719:16614058:1 gene:ENSCAFG00000010394 transcript:ENSCAFT00000016519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELSHVQKQLDLQNGSLEAGFGANSPDDDDDDDRSQTMMESLSPKKYSSSLRFKANGDY
SGSYLTLSQPLPARRSPSPLGSGARSSPSLARGPGGRQLPGAGSGSGSGRPPAPPLGACA
PGRPDPERPLRLADRPPYCKYSLQEQVPDKVSFCDPWRPEARCEAGPPAPGSGAANMPSS
PKQARRMGLQDRPGRPREPPPDAAAPRARRPAGGGLGHMGAHSRSLPRLHRAADGPQLSL
PPRAALGGARRTRPGDREPPPSCAEHDGYLSFSSWSAGPAPYRPAAAEGAPYASSTLSIP
ASPRVARKMLLASAAPCAPCAPCAPPARRNLSWGSAELDDPDPDPDPDRDPDPDGLRQAA
GTPQPALRERKSSISSISGREDLMDYHRRQREERLREQEMERLERQRLETILSLCAEYTK
PDSRLSTGTSVADVQKINKELEKLQLSDEESVFEEAVVSPDARYRCHQKASLHDADLPVF
GSIGQSSASLLSPRSIRNDDLLRDFTSAFLKTSSESAYLSILPKTPEGINEEQRIQELAA
MEETRITILNNLEELEQKIKDINDQMDESSRELDMECALLDGEQKSETTELMKEKEILDH
LNRKIAELEKNIVGEKTKEKVKLDAEREKLERLQELYSEQKTQLDNCPESMREQLQQQLK
RDADLLDVESKHFEDLEFQQLERESRLDEEKENLTQQLLREVAEYQRNIVTRKEKISALK
KQANHIVQQAQREQDHFVKEKNNLIMMLQREKENLCNLEKKYSSLSGGKGFPVNPSTLKE
GYISVNEFNEPCVNSTNLSPSTQFPADADAVATGPTTAVLVSQPQNKEHFRSLEERKKQH
KEGLYLSDTLPRKKTTPSISPHFSSATMGRSTTPKAHLPLGQSNSCGSVLPHSLATMTKD
SDSRRMLRGYNHQQMSEGQRQKSEFYNRTASESNVYLNSFHYPDHSYKDQAFDTLSLDSS
DSMETSISACSPDNISSASTSNIARIEEMERLLKQAHAEKTRLLESREREMEAKKRALEE
EKRRRELLEKRLQEETSQRQKLIEKEVKIREKQRAQARPLTRYLPVRKEDFDLRSHVETA
GHNIDTCYHVSITEKTCRGFLIKMGGKIKTWKKRWFVFDRNKRTFSYYADKHEAKLKGVI
YFQAIEEVYYDHLKNANKSPNPLLTFSVKTHDRIYYMVAPSPEAMRIWMDVIVTGAEGYT
HFLL
Download sequence
Identical sequences E2RDB9
ENSCAFP00000015282 ENSCAFP00000015282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]