SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000015285 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000015285
Domain Number 1 Region: 179-279
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-34
Family Phosphotyrosine-binding domain (PTB) 0.00000212
Further Details:      
 
Domain Number 2 Region: 31-131
Classification Level Classification E-value
Superfamily PH domain-like 6.72e-28
Family Phosphotyrosine-binding domain (PTB) 0.00000534
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000015285   Gene: ENSCAFG00000010397   Transcript: ENSCAFT00000016522
Sequence length 1191
Comment pep:known_by_projection chromosome:CanFam3.1:25:39684358:39688221:-1 gene:ENSCAFG00000010397 transcript:ENSCAFT00000016522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AASPPAHEAPVNGGGGGGSMASPPETDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGP
ARLEYYENEKKWRHKSSAPKRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEA
EQDSWYQALLQLHNRAKGHHDGASAPGAGGGGGSCSGSSGLGEAGEDLSYGDVPPGPAFK
EVWQVILKPKGLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFF
FIEVGRSAVTGPGEFWMQVDDSVVAQNMHETILEAMRAMSDEFRPRSKSQSSSNCSNPIS
VPLRRHHLNNPPPSQVGLTRRSRTESITATSPASMVGGKQGSFRVRASSDGEGTMSRPAS
VDGSPVSPSTTRTHAHRHRGSSRLHPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHG
STSDCLFPRRSSASVSGSPSDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEE
GGNGHRYIPGAGLGTSPALAADEAAAAADLDNRFRKRTHSAGTSPTISHQKTPSQSSVAS
IEEYTEMMPAYPPGGGSGGRLPGYRHSAFVPTHSYPEEGLEMHPLDRRGGHHRPDAAALH
TDDGYMPMSPGVAPVPSSRKGSGDYMPMSPKSVSAPQQIINPIRRHPQRVDPNGYMMMSP
SGSCSPDIGGGPGSSSSGSAAPSGSSYGKLWTNGVGGHHPHALPHPKLPVESGSGKLLSC
TGDYMNMSPVGDSNTSSPSDGYYGPEDPQHKPVLSYYSLPRSFKHTQRPGELEESARHST
SASPPARVVFSTPRRRKIPPPPPAATAWAQGDTVGPHIHHQVLQPHLPRKVDTAAQTNSR
LARPTRLSLGDPKASTLPRVREQQHPPPLLHPPEPKSPGEYVNIEFGSDQPGYLSGPVAA
RSSPSVRCPPQLQPAPREEETGTEEYMNMDLGPGRRAAWQEGAGVQPGRVGPAPPGAASV
CRPTRAVPSSRGDYMTMQVGCPGQGYVDTSPVAPISYADMRTGIVVEEASLPGATAAAPS
SASAASASPTAPPKAGELVARSSLLGGPQGPGGMSAFTRVNLSPNRNQSAKVIRADPQGC
RRRHSSETFSSTPSATRAGNAVPFGGGAALGGSGGGSSAEDMKRHSSASFENVWLRPGEL
GGAPKEPAPHAGAAGGLENGLNYIDLDLVKDFKQCSQERPPQPQPPPPPAP
Download sequence
Identical sequences E2RDB5
ENSCAFP00000015285 ENSCAFP00000015285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]