SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000015301 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000015301
Domain Number 1 Region: 409-517
Classification Level Classification E-value
Superfamily PDZ domain-like 6.44e-25
Family PDZ domain 0.0033
Further Details:      
 
Domain Number 2 Region: 17-112
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-22
Family PDZ domain 0.0000887
Further Details:      
 
Domain Number 3 Region: 167-270
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-19
Family PDZ domain 0.025
Further Details:      
 
Domain Number 4 Region: 690-800
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000835
Family Nucleotide and nucleoside kinases 0.001
Further Details:      
 
Domain Number 5 Region: 518-594
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000604
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000015301   Gene: ENSCAFG00000010407   Transcript: ENSCAFT00000016538
Sequence length 1739
Comment pep:known chromosome:CanFam3.1:3:38997127:39078127:-1 gene:ENSCAFG00000010407 transcript:ENSCAFT00000016538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSSRSPIKQNTAMEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVL
KGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVSRPD
PEPVSENEDSYDEEVHDPRSSRGGLVSRRSEKSWARDRSASRERSLSPRSDRRSVASSQP
PKPTKVTLVKSRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENMS
LTDAKTLIERSKGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHSG
RSHDRPPRHSRSRSPDQRSEPSDHSRHSPQQPSSGSLRSREEERISKPGAVSTPVKHADD
HTHKTVEEVVVERNEKQAPSLPEPKPVYAQVGQPDVDLPVSPSDGVLPNSTHEDGILRPS
MKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIRE
EAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGE
VFRVVDTLYNGKLGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRADF
WRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREKL
AREEPDIYQIAKSEPRDAGTDQRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQW
YPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMNDG
WYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTS
DYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHENQTYPPYSPQ
AQPQPIHRIDSPGFKTASQQKAEASSPVPYLSPETNPASSTSAVNHNVTLTNVRLEGPTP
APSTSYSPQADSLRTPSTEAAHIMLRDQEPSLPSHVEPAKVYRKDPYPEEMMRQNHVLKQ
PAVGHPGQRPDKEPNLSYESQPPYVEKQANRDLEQPTYRYDSSSYTDQFSRNYDHRLRYE
ERIPTYEEQWSYYDDKQPYQPRPSLDNQHPRDLDSRQHPEESSERGYYPRFEEPAPLSYD
SRPRYDQPPRTSTLRHEEQPTPGYDMHNRYRPEAQSYSSAGPKASEPKQYFDQYPRSYEQ
VPSQGFSSKAGHYEPLHGAAVVPPLIPASQHKPEVLPSNTKPLPPPPTLTEEEEDPAMKP
QSVLTRVKMFENKRSASLENKKDENHTAGFKPPEVASKPPGAPIIGPKPTPQNQFSEHDK
TLYRIPEPQKPQMKPPEDIVRSNHYDPEEDEEYYRKQLSYFDRRSFENKPSTHIPAGHLS
EPAKPVHSQNQTNFSSYSSKGKSPEADAPDRSFGEKRYEPVQATPPPPPLPSQYAQPSQP
GTSSSLALHTHAKGAHGEGNSISLDFQNSLVSKPDPPPSQNKPATFRPPNREDTVQSTFY
PQKSFPDKAPVNGAEQTQKTVTPAYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETAH
KPDLSSKAPASPKTLAKAHSAAQPPEFDSGVETFSIHADKPKYQMNNLSTVPKAIPVSPS
AVEEDEDEDGHTVVATARGVFNNNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDN
SILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSG
Download sequence
Identical sequences F1PMA1
ENSCAFP00000015301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]