SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000015343 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000015343
Domain Number 1 Region: 19-120
Classification Level Classification E-value
Superfamily Fibronectin type III 1.88e-18
Family Fibronectin type III 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000015343   Gene: ENSCAFG00000010445   Transcript: ENSCAFT00000016581
Sequence length 216
Comment pep:known_by_projection chromosome:CanFam3.1:2:68485880:68494158:1 gene:ENSCAFG00000010445 transcript:ENSCAFT00000016581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPGPPRAALRLWLGCVCLALVQADSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAI
SQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPRE
AEKMASKNKDEVTMKEMAGSQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNN
KEKTKSASENSTPEHQGGGLLRSKFPNKPSVNIIEA
Download sequence
Identical sequences F1PLK7
ENSCAFP00000015343 XP_013965217.1.84170 ENSCAFP00000015343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]