SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000015355 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000015355
Domain Number 1 Region: 163-387
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.39e-47
Family Ankyrin repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 619-718
Classification Level Classification E-value
Superfamily PDZ domain-like 3.46e-20
Family PDZ domain 0.0000279
Further Details:      
 
Domain Number 3 Region: 515-589
Classification Level Classification E-value
Superfamily SH3-domain 5.12e-18
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000015355   Gene: ENSCAFG00000010458   Transcript: ENSCAFT00000016593
Sequence length 811
Comment pep:known_by_projection chromosome:CanFam3.1:18:47404040:48062551:1 gene:ENSCAFG00000010458 transcript:ENSCAFT00000016593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSPTSSEDEMAQSFSDYSVGSESDSSKEETIYDTIRATAEKPSVARTEESQGNTLVIR
ILIQDLQQTKCIRFNPDATVWVAKQRILCSLNQSLKDVLNYGLFQPASNGRDGKFLDEER
LLREYPQPVGKGIPSLEFRYKKRVYKQSNLDEKQLAKLHTKTNLKKFMDHIQHRLVEKVV
KMLERGLDPNFHDPETGETPLTLAAQLDDPTEVIKALRNGGAHLDFRARDGMTALHKAAR
ARNQVALKTLLELGASPDYKDSYGLTPLYHTAIVGGDPYCCELLLHEHAAVCCRDENGWH
EIHQACRYGHVQHLEHLLFYGADMAAQNASGNTALHICALYNQDSCARVLLFRGGNKEQK
NYHSQTPFQVAIIAGNFELAEYIKNHKETDIVPFREAPAYSNRRRRPPNTLAAPRVLLRS
NSDNNLNASAPDWAVCSATSHRSLSPQLLQQVPGKPDGAARTLGSYTPGPRSRSPSLNRL
GGAGEDGKRPQQPWHVGPAFPPGASRDALSAFEYPEPKRKLYSAVPGRLFVVVKPYHPQV
DGEIPLHRGDRVKVLSIGEGGFWEGSARGHIGWFPAECVEEVQCRPKDSQAETRADRSKK
LFRHYTVGSYDSFDATSDCIIEEKTVVLQKKDNEGFGFVLRGAKADTPIEEFTPTPAFPA
LQYLESVDEGGVAWQAGLRTGDFLIEVNNENVVKVGHRQVVNMIRQGGNHLVLKVVTVTR
NLDPDDTARKKAPPPPKRAPTTALTLRSKSMTSELEELDKPEEIVPASKPSRAADNVAME
SRVATIKQRPTSRCFPSVSDMNVSHWPCPVG
Download sequence
Identical sequences E2RNK4
ENSCAFP00000015355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]