SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000015434 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000015434
Domain Number 1 Region: 63-374
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.56e-84
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000329
Further Details:      
 
Domain Number 2 Region: 373-474
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.00000000005
Family Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000015434   Gene: ENSCAFG00000010496   Transcript: ENSCAFT00000016678
Sequence length 477
Comment pep:known_by_projection chromosome:CanFam3.1:27:16139499:16160549:1 gene:ENSCAFG00000010496 transcript:ENSCAFT00000016678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPMLRRFPRGRRFGTPGVSGVLLLGQREARSGAQGLLAVQKARGLFKEFFPEKGTKVE
LPELLDRGSGSFPQTVYCGFDPTADSLHVGHLLTLLGLFHFQRAGHNVIALVGGATARLG
DPSGRPKEREALAPEQVRGNARALRRGLEAVAANHQRLFANGRPWGSFTVLDNAAWYQGQ
HLVDFLAAVGGHFRMGTLLSRASVQARLQSAGGMSLAEFLYQVLQAYDFYYLFQHYGCRV
QLGGSDQLGNITSGYEFIHKLTGEDVFGITVPLVTSTTGAKLGKSAGNAVWLNREKTSPF
ELYQFFVRQQDNLVERYLKLFTFLPLPEIDHIMQLHDKEPEKRGPQKRLAAEVTKLVHGQ
EGLDSAKRCTQALYHSSIDALEVMSDQELKELFKEASFSELVLDPGTSVLDICRKANAIP
DGPRGYRMITEGGVSINHRQVTNPESVLVVGQHILKNGLSLLKIGKRNFYIIKWLQL
Download sequence
Identical sequences E2RHU6
ENSCAFP00000015434 9615.ENSCAFP00000015434 ENSCAFP00000015434 XP_543740.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]