SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000015548 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000015548
Domain Number 1 Region: 162-255
Classification Level Classification E-value
Superfamily PH domain-like 5.75e-29
Family Pleckstrin-homology domain (PH domain) 0.0000049
Further Details:      
 
Domain Number 2 Region: 28-132
Classification Level Classification E-value
Superfamily SH2 domain 4.58e-27
Family SH2 domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000015548   Gene: ENSCAFG00000010571   Transcript: ENSCAFT00000016802
Sequence length 280
Comment pep:known_by_projection chromosome:CanFam3.1:32:21766585:21811934:1 gene:ENSCAFG00000010571 transcript:ENSCAFT00000016802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAESLEGKMSTQDPSDLWSRSDGDAELLQELGWYHGNLTRHAAEALLLSNGCDGSYLL
RDSNERTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETG
TLIVLKHPYPRKVEEPSIYESVRVHTAMQTGRTENDLVPTAPSLGTKEGYLTKQGGLVKT
WKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLC
AKTGVEADEWIKILRWKLSQIRKQLDQGEGTIRSRSFIFK
Download sequence
Identical sequences E2QWT8
ENSCAFP00000015548 ENSCAFP00000015548 XP_013965535.1.84170 XP_535669.2.84170 9615.ENSCAFP00000015548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]