SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000015594 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000015594
Domain Number 1 Region: 311-524
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.09e-59
Family DBL homology domain (DH-domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 507-668
Classification Level Classification E-value
Superfamily PH domain-like 2.26e-34
Family Pleckstrin-homology domain (PH domain) 0.0026
Further Details:      
 
Domain Number 3 Region: 691-852
Classification Level Classification E-value
Superfamily PH domain-like 1.16e-22
Family Pleckstrin-homology domain (PH domain) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000015594   Gene: ENSCAFG00000010589   Transcript: ENSCAFT00000016851
Sequence length 880
Comment pep:known_by_projection chromosome:CanFam3.1:27:16257815:16350143:-1 gene:ENSCAFG00000010589 transcript:ENSCAFT00000016851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIIKRVKPNISLSKQVRLIISICEVMSTDQGSSICPKITIVPPYVKNSRTPLVDQNVSNE
EAQGINGKTPAKHSAASPKPQVPPKPLYLRNSPSSKIHQTPRHKALSSAEPRMEKEVKPA
SASCVSKEKPSKVSDLISRFEGGSTLSTYSDLKKDSGVNLNVPRTPGRHGLTTTPQRKLV
SQQPPQKQENDTDPTQGVQTDVANGVMAAQNQMECEEDKVVTVSPETPVQTSEPLLAVNL
VNGEGEEEATTRPATPTANDYDGNASDSSCRTPRVSQVLPPEEGRADMEAKVQEQEDGES
PLEPEQLDQHPEMKETNEEKLHKIANELLLTERAYVNRLDLLDQVFYCKLLEEANRGSFQ
AEMVNKIFSNISSINAFHSKFLLPELEKRMQEWETTPRIGDILQKLAPFLKMYGEYVKGF
DNAMELVKNMTERIPQFKAVVEEIQKQKICGSLTLQHHMLEPVQRIPRYEMLLKDYLRKL
PPDSPDWNDAKKSLEIISTAASHSNSAIRKMENLKKLLEIYEMLGEEEDIVNPSNELIKE
GQILKLAARNTSAQERYLFLFNNMLLYCVPRFSLVGSKFTVRTRVGIDGMKIVETHNEEY
PHTFQVSGKERTLELQASSEQDKEEWIKALQETIDAFHQRHETFRNAIAKDNDMHSEVST
AELGKRAPRWIRDNEVTMCMKCKESFNALTRRRHHCRACGHVVCWKCSDYKAQLEYDGGK
LNKVCKDCYQIISGFTDSEEKKRKGILEIESAEVSGNSIVCSFLQYMEKSKPWQKAWCVI
PKQDPLVLYMYGAPQDVRAQATIPLLGYVVDDMPRSADLPHSFKLTQSKSVHSFAADSEE
LKQKWLKIIFLAVTGETPDGPNKHPATLDDHPESKKKSEC
Download sequence
Identical sequences F6XTP6
ENSCAFP00000015594 ENSCAFP00000015594 XP_003433606.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]