SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000015605 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000015605
Domain Number 1 Region: 352-463
Classification Level Classification E-value
Superfamily SH2 domain 4.04e-33
Family SH2 domain 0.00000474
Further Details:      
 
Domain Number 2 Region: 28-124
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.13e-32
Family Ras-binding domain, RBD 0.00031
Further Details:      
 
Domain Number 3 Region: 155-269
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000255
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000015605   Gene: ENSCAFG00000010563   Transcript: ENSCAFT00000016861
Sequence length 466
Comment pep:known_by_projection chromosome:CanFam3.1:36:9710116:9824676:-1 gene:ENSCAFG00000010563 transcript:ENSCAFT00000016861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSIPNPFPELCCSPFTSVLSAGLFPKANSRKKQVIKVYSEDETSRALEVPSDITARDVC
QLLILKNHYIDDHSWTLFEHLPHIGLERTMEDHELVIEVLSNWGMEEENKLYFRKNYAKY
EFFKNPMYFFPEHMVSFATETNGEISPTQILQMFLSSSTYPEIHGFLHAKEQGKKSWKKI
YFLLRRSGLYFSTKGTSKEPRHLQFFSEFGNSDIYVSLAGKKKHGAPTNYGFCFKPNKAG
GPRDLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNYMHPYQGRSGCSSQSISPMRSISEN
SLVAMDFSGQKSRVIENPTEALSVAVEEGLAWRKKGCLRLATHGSPTASSQSSATNMAIH
RSQPWFHHKISREEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMSHGQKIKHFQIIPVE
DDGELFHTLDDGHTRFTDLIQLVEFYQLNKGVLPCKLKHYCARIAL
Download sequence
Identical sequences F1PSX8
ENSCAFP00000015605 ENSCAFP00000015605 XP_005640314.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]