SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000015750 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000015750
Domain Number 1 Region: 88-174
Classification Level Classification E-value
Superfamily Cyclin-like 8.02e-30
Family Cyclin 0.0012
Further Details:      
 
Domain Number 2 Region: 176-277
Classification Level Classification E-value
Superfamily Cyclin-like 4.26e-18
Family Cyclin 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000015750   Gene: ENSCAFG00000010700   Transcript: ENSCAFT00000017023
Sequence length 317
Comment pep:known_by_projection chromosome:CanFam3.1:18:48501927:48510858:-1 gene:ENSCAFG00000010700 transcript:ENSCAFT00000017023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHLCSFIAKQKCLLIIGGRVGAGSGRRGAGAAARGRAAAGSGREGRGAGARAAGGDPAR
GEGPLCSSCESRGAPHGQPGPESTPSCKVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSR
LQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPH
DFIEHFLSKMPVAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLHLG
SSNSFLSYHRLTRFLSKVIKCDADCLRACQEQIEALLESSLRQAQQQSLDPKAAEEEEEE
EEADLACTPTDVRDVNI
Download sequence
Identical sequences F1PPQ3
ENSCAFP00000015750 ENSCAFP00000015750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]