SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000016021 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000016021
Domain Number 1 Region: 197-509
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 5.09e-87
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000681
Further Details:      
 
Domain Number 2 Region: 1019-1286
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.59e-73
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000799
Further Details:      
 
Domain Number 3 Region: 504-707
Classification Level Classification E-value
Superfamily Ribosomal protein L25-like 1.1e-52
Family Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain 0.00043
Further Details:      
 
Domain Number 4 Region: 1289-1418
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.76e-29
Family Anticodon-binding domain of Class II aaRS 0.00015
Further Details:      
 
Domain Number 5 Region: 1422-1509
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 2.94e-17
Family C-terminal domain of ProRS 0.0071
Further Details:      
 
Domain Number 6 Region: 752-805
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 8.63e-17
Family a tRNA synthase domain 0.0000671
Further Details:      
 
Domain Number 7 Region: 50-162
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.99e-16
Family Glutathione S-transferase (GST), C-terminal domain 0.042
Further Details:      
 
Domain Number 8 Region: 901-952
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.00000000000000306
Family a tRNA synthase domain 0.00045
Further Details:      
 
Domain Number 9 Region: 823-877
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.0000000000000118
Family a tRNA synthase domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000016021   Gene: ENSCAFG00000010873   Transcript: ENSCAFT00000017310
Sequence length 1509
Comment pep:known_by_projection chromosome:CanFam3.1:38:14754125:14824003:-1 gene:ENSCAFG00000010873 transcript:ENSCAFT00000017310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATLCLTVNAGDPPLGALLAVEHVKDNISISVEEGKENILHVSENVVFTDINSILRYLAR
VATTTGLYGSNLLEHTEIDHWLEFSATKLSSCNLFTSAINELNHCLSLRTYLVGNSLSLA
DLCVWATLKGNAAWQEQLKQNKAPVHIKRWFGFLEAQQAFQSVGTKWNISATKAKVTPEK
KQDVGKFVELPGAEMGKVTVRFPPEASGYLHIGHAKAALLNQHYQVNFKGKLIMRFDDTN
PEKEKEDFEKVILEDVAMLHIKPDQFTYTSDHFETIMKYAEKLIQEGKAYVDDTPAEQMK
AEREQRIESKHRKNSVEKNLQMWEEMKKGSQFGQSCCLRAKIDMSSNNGCMRDPTLYRCK
IQPHPRTGNKYNVYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWIIEALGIRKPYI
WEYSRLNLNNTVLSKRKLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGS
SRSVVNMEWDKIWAFNKKVIDPVAPRYVALLKKEVIPVNIPEAQEEMKEVAKHPKNPDVG
LKPVWYSSKVFIEGADAETLSEGEMVTFINWGNINIAKIHKNADGKIESLDAKLNLENKD
YKKTTKITWLAETAHALPIPAICVTYEHLITKPVLGKDEDFKQYVNKNSKHEELMLGDPC
LKDLKKGDIIQLQRRGFFICDQPYEPVSPYSCKEAPCVLIYIPDGHTKEMPTSGSKEKTK
VETTKNEPTTPFKEKAGPSLLNTCATFEDSLVLYNRVAAQGDVVRELKAKKAAKEDIDAA
VKQLLALKAEYKEKTGQEYKPGNPPAVVPNVSSTSSASIVESKSLYDEVAAQGEVVCKLK
AEKAPKAKVNEAVECLLSLKAQYKEKTGKEYIPGQPPLSQSSHSTAGSESSGPEAPEAKV
LFDKVASQGEVVRKLKAEKASKDQVDVAVQELLQLKAQYKSLTGVEYKPVSATGAEDKDK
KKKEKENKSEKQNKPLKQSDGQKKDSYKNQGSGLSSSGAGEGQGPKKQTRLGLEAKKEEN
LADWYSQVITKSEMIEYYDVSGCYILRPWAYSIWESIKDFFDAEIKKLGVENCYFPMFVS
QGALEKEKTHVADFAPEVAWVTRSGKTELAEPIAVRPTSETVMYPAYAKWVQSHRDLPIR
LNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATFEEAAEEVLQILDLYAKVYEELLAI
PVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGATSHHLGQNFSKMFEIIFEDPKTPG
EKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVASVQVVVIPCGITNALSEEDRDAL
IIKCNDYRRRLLSVNVRVKVDLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVR
RDTGEKLTVADNEAETKLKAILEDIHVNLFTRASEDLKTHMVVANTMEDFQKMLDSGKIA
QIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCELQPGAKCICGKNPAK
YYTLFGRSY
Download sequence
Identical sequences E2QUR2
ENSCAFP00000016021 9615.ENSCAFP00000016021 XP_849468.1.84170 ENSCAFP00000016021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]