SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000016060 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000016060
Domain Number 1 Region: 187-407
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.18e-70
Family Nuclear receptor ligand-binding domain 0.00000582
Further Details:      
 
Domain Number 2 Region: 76-152
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.04e-29
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000016060   Gene: ENSCAFG00000010911   Transcript: ENSCAFT00000017350
Sequence length 420
Comment pep:known_by_projection chromosome:CanFam3.1:3:44136623:44142321:-1 gene:ENSCAFG00000010911 transcript:ENSCAFT00000017350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQ
GGPGGPGGDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRN
CPIDQHHRNQCQYCRLKKCLKVGMRREAPFLPAAVQRGRMPPTQPTHGQFALTNGDPLNC
HSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFP
DLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRI
FQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYP
NQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ
Download sequence
Identical sequences F1PX81
ENSCAFP00000016060 ENSCAFP00000016060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]