SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000016153 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000016153
Domain Number 1 Region: 300-604
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 9.68e-115
Family Mammalian PLC 0.000000379
Further Details:      
 
Domain Number 2 Region: 140-298
Classification Level Classification E-value
Superfamily EF-hand 3.46e-38
Family EF-hand modules in multidomain proteins 0.015
Further Details:      
 
Domain Number 3 Region: 625-749
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.13e-31
Family PLC-like (P variant) 0.00036
Further Details:      
 
Domain Number 4 Region: 11-124
Classification Level Classification E-value
Superfamily PH domain-like 1.04e-26
Family Pleckstrin-homology domain (PH domain) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000016153   Gene: ENSCAFG00000010953   Transcript: ENSCAFT00000017444
Sequence length 997
Comment pep:known_by_projection chromosome:CanFam3.1:37:7489520:7565314:1 gene:ENSCAFG00000010953 transcript:ENSCAFT00000017444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSEKKISSASDCISFMQAGCELKKVRPNSRIYNRFFTLDTDLQALRWEPSKKDLEKAKL
DISAIKEIRLGKNTETFRNNGLADQICEDCAFSILHGENYESLDLVANSADVANIWVSGL
RYLVSRSKQPLDFMEGNQNTPRFMWLKTVFEAADIDGNGIMLEDTSVELIKQLNPTLKES
KIRLKFKEIQKSKEKLTTRVTEEEFCEAFCELCTRPEVYFLLVQISKNKEYLDANDLMLF
LEAEQGVAHITEDMCLDIIRRYELSEEGRQKGFLAIDGFTQYLLSPECDIFDPEQKKVAQ
DMTQPLSHYYINASHNTYLIEDQFRGPADINGYVRALKMGCRSIELDVSDGSDNEPILCN
RNNVTTHLSFRSVIEVINKFAFVASEYPLILCLGNHCSLPQQKIMVQQMKKVFGDKLYVE
APLPSETYLPSPEKLKRMIIVKGKKLPSDPDVLEGEVTDEDEEAEMSRRLSVDYNGEQKQ
ILLCKELSDLVSICKSVQYRDFELSMKSQNYWEMCSFSETEASRIANEYPEDFVNYNKRF
LSRVYPSAMRIDSSNLNPQDFWNCGCQIVAMNFQTPGPMMDLHTGWFLQNGGCGYVLRPS
IMRDEVSYFSANTKGIVPGVSPLALHIKIISGQNFPKPKGACAKGDVIDPYVCIEIHGIP
ADCSEQRTKTVQQNSDNPIFDETFEFQVNLPELAMIRFVVLDDDYIGDEFIGQYTIPFEC
LQPGYRHVPLRSFVGDIMEHVTLFVHIAITNRSGGGKAQKRSLSVRMGKKVREYTMLRNI
GLKTIDDIFKIAVHPLREAIDMRENMQNAIVSIKELCGLPPIASLKQCLLTLSSRLITSD
NTPTVSLVMKDNFPYLEPLGAIPDVQKKMLAAYDLMIQESRFLIEMADTVQEKIVQCQKS
GMEFHEELHNLGAKEGLKGRKLNKATESFAWNITVLKGQGDLLKNAKNEAVENMKQIQLA
CLSCGLSKAPSSGAEAKSKRSLEAIEEKESGEENGKL
Download sequence
Identical sequences F1Q376
ENSCAFP00000016153 XP_005640559.1.84170 ENSCAFP00000016153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]