SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000016174 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000016174
Domain Number 1 Region: 614-856
Classification Level Classification E-value
Superfamily VPS9 domain 1.83e-49
Family VPS9 domain 0.00074
Further Details:      
 
Domain Number 2 Region: 49-172
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000000105
Family SH2 domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000016174   Gene: ENSCAFG00000010958   Transcript: ENSCAFT00000017468
Sequence length 871
Comment pep:known_by_projection chromosome:CanFam3.1:8:1733057:1802435:1 gene:ENSCAFG00000010958 transcript:ENSCAFT00000017468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSPVPGVGKEEGEEEEEEDVMGPCLPVSPKNCLPLRGISVLEKLIKTCPVWLQLGLGRME
AARILQQEAAGTFLVCQDSSLKHLVLCVHFPSPNESSSKVLEYTVKEEKSILYLEGSVLV
FEDIFRLIAFYCVSRDLLPFTLRLPQAILEASSFTDLETISNLGLGFWDSSLNPRRGSGS
SAEPPRDPAPRAPPACGLRPTARPGNCSCEIELSVGNDRLWFVNPIFIEDCGGGGALPVA
PPSPGSCPTRPLPPASCATSPTSRWAPRRPAPPPPAPPPPAPPLQPSGPQRPPPPPALVP
ACPLPSSPPASAPHLAPHAPGPPDLPSQAPMAACERLSRPPTGLGPLREEEMKPGPAPGP
LPQPPAPLIPVKSLPAAPPRRRISEKVSLEDQAAGRVDRTLPAVGEQPGLPRAPVLSPPP
PGTSEQGQEVVARAGDPGSVPEPPRKVRQPPVPPPRRKRISRQLASGLPGPVESTESSSM
KDEAPQKPTPGAPGEGRGPASCARTQSPQAQAGSRPQSSAEFKGSLASLSDSLGASALAA
DQDSYSTSSTEEEPEHLGGAGKKKPSVILGKARHRLSFVSFTNVFHAFLSNDRKLYKKVV
ELAQDKASYFGNLVQDYKVYSLEMMARQTSSTEMLQEIRTMMTQLKSYLLQSTELKALVD
PALHPEEELEAIVESALYKCVLKPLKEAINACLREIHSKDGSLQQLKENQLVVLATTTTD
LGVTTSVPEAPVMEKILQKFTSMHKAYSPEKKIAILLKTCKLIYDSMALGNPGKPYGADD
FLPVLMYVLARSNLAEMLLNVEYMMELMDPALQLGEGSYYLTTTYGALEHIKNYDKITVT
RQLSVEVQDSIHRWERRRTLNKARASRSSVQ
Download sequence
Identical sequences F1Q2X0
ENSCAFP00000016174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]