SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000016240 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000016240
Domain Number 1 Region: 17-188
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-50
Family DBL homology domain (DH-domain) 0.0000385
Further Details:      
 
Domain Number 2 Region: 174-320
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-34
Family Pleckstrin-homology domain (PH domain) 0.00061
Further Details:      
 
Domain Number 3 Region: 434-565
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.43e-32
Family DEP domain 0.0012
Further Details:      
 
Domain Number 4 Region: 337-451
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.86e-27
Family DEP domain 0.0037
Further Details:      
 
Domain Number 5 Region: 549-633
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000146
Family PDZ domain 0.027
Further Details:      
 
Domain Number 6 Region: 638-702
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000493
Family PDZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000016240   Gene: ENSCAFG00000010948   Transcript: ENSCAFT00000017540
Sequence length 1586
Comment pep:known_by_projection chromosome:CanFam3.1:24:35404729:35503371:-1 gene:ENSCAFG00000010948 transcript:ENSCAFT00000017540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFLHRIRQNVADSVEKGLTEENVKILFSNIEDILEVHKDFLAALEYCLHPEPQSQHELGN
VFLRFKDKFCVYEEYCSNHEKALRLLVELNKIPTVRAFLLSCMLLGGRKTTDIPLEGYLL
SPIQRICKYPLLLKELAKRTPGKHPDHPAVQSALQAMKTVCSNINETKRQMEKLEALEQL
QSHIEGWEGSNLTDICTQLLLQGTLLKISAGNIQERAFFLFDNLLVYCKRKSRVTGGKKS
TKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSNGYTVTNGWKIHNTAKNKWFVCM
AKTAEEKQKWLDAIIREREQRESLKLGMERDAYVMIAEKGEKLYHMMMNKKVNLIKDRRR
KLSTVPKCFLGNEFVAWLLEIGEISKTEEGVNLGQALLENGIIHHVSDKHQFKNEQVMYR
FRYDDGTYKARSELEDIMSKGVRLYCRLHSLYTPVIKDRDYHLKTYKSVLPGSKLVDWLL
AQGDCQTREEAVALGVGLCNNGFMHHVLEKSEFKDESQYFRFHADEEMEGTSTKNRQLRN
DFKLVENILAKRLLILPQEDDYGFDIEEKNKAVVVKSVQRGSLADMAGLQVGRKIYSINE
DLVFLRPFSEVESILNQSFCSRRPLRLLVATKAKEIIKVPDHPEALCFQIRGAAPPYVYA
VGRGSEAAAAGLCAGQCILKVNGNNVVNDGAAEVLEHFQAFRSHQEEALGLYQWVYHTHE
DAQEARGSQEAPGEDPQSDSVNQQDQGLPAFPLLSLGPQLSLHEDSPVVTLTVDNVHLEH
GVVYEYVSTAGIKCHVLEKIVEPRGCFGLTAKILKAFAADDNVFVQNCGRLMALNNNIRT
MFHYEFRNICDTKLESIGQRIACYQEFAAQLENRLSPPFKQASLEPHPLCGLDFCPTNCH
VNLMEVSYPKTTPSVGRSFSIRFGRKPSLIGLDPEQGHLNPMSYTQHCITTMAAPSWKCL
PAADGDLQLWGLHDSSFGSANETIGQEDRGLSFLLKQEDREIQGAYLQLFTRLDVALKEM
KQYVTQINRLLSTITEPTSGGSCDPPLAEEASSPPLVSEESEMDRADHGGIKKVCFKVSE
EDQEDSGHDTMSYRDSYSECNSNRDSVLSYTSVRSNSSYLGSDEMGSGDELPCDMRIPSD
KQDKLHGCLEHLFNQVDSIHTLLKGPVMSRAFEETKHFPMDHSLQEFKQKEECTIRGRSL
IQISIQEDPWNLPNSIKTLVDNIQRYVEDGKNQLLLALLKCTDTELQVRRDTIFCQALVA
AVCTFSEQLLAALSYRYNNNGEYEESSRDASRKWLEQVAATGVLLHCQSLLSPAAAKEER
TMLEDLWVTLSELDNVSFSFKQLDENYVANTNVFYHIEGSRQALKVVFYLDSYHFSKLPS
RLEGGASLRLHTVLFTKALENVEGPPPTGSQAAEDLQQEINTQSLEKVQQYYRKLRAFYL
ERSNLPTDASTTAVKIDQLIRPINALDELCRLMKSFVHPKPGTSGNLGAGLIPISSELCY
RLGACQIAMCGTGMQRSTLSVSLEQAAILARSHGLLPKCIMQATDIMRKQGPRVEILAKN
LRVKDQMPQGAPRLYRLCQPPVDGDL
Download sequence
Identical sequences F1Q1L2
ENSCAFP00000016240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]