SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000016469 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000016469
Domain Number 1 Region: 396-619
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.28e-75
Family ATP sulfurylase catalytic domain 0.00000000136
Further Details:      
 
Domain Number 2 Region: 226-393
Classification Level Classification E-value
Superfamily PUA domain-like 4.67e-53
Family ATP sulfurylase N-terminal domain 0.0000000257
Further Details:      
 
Domain Number 3 Region: 35-226
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.06e-41
Family Adenosine-5'phosphosulfate kinase (APS kinase) 0.000000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000016469   Gene: ENSCAFG00000011167   Transcript: ENSCAFT00000017790
Sequence length 625
Comment pep:known_by_projection chromosome:CanFam3.1:32:28136473:28235444:-1 gene:ENSCAFG00000011167 transcript:ENSCAFT00000017790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVPGSLCKKVKLSNSNAQNWGMQRATNVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTG
LSGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKL
FADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARA
GEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYV
PENKLHLAKTDAETLPALKINKVDMQWVQVLAEGWATPLNGFMREREYLQCLHFDCLLDG
GVINLSVPIVLPATHEDKERLDGCTAFALMYEGRRVAILRNPEFFEHRKEERCARQWGTT
CKNHPYIKMVMEQGDWLIGGDLQVLDRIYWNDGLDQYRFTPTELKQKFKDMNADAVFAFQ
LRNPVHNGHALLMQDTHKQLLERGYRRPVLLLHPLGGWTKDDDVPLMWRMKQHAAVLEEG
ILNPETTVVAIFPSPMMYAGPTEVQWHCRARMVAGANFYIVGRDPAGMPHPETGKDLYEP
THGAKVLTMAPGLITLEIVPFRVAAYNKKKKRMDYYDSEHHEDFEFISGTRMRKLAREGQ
KPPEGFMAPKAWTVLMEYYKSLEKA
Download sequence
Identical sequences E2QZ13
ENSCAFP00000016469 9615.ENSCAFP00000016469 XP_013965516.1.84170 ENSCAFP00000016469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]