SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000016695 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000016695
Domain Number 1 Region: 6-121
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.41e-42
Family Pyk2-associated protein beta ARF-GAP domain 0.0021
Further Details:      
 
Domain Number 2 Region: 248-357
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-23
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 3 Region: 121-229
Classification Level Classification E-value
Superfamily PH domain-like 1.45e-17
Family Pleckstrin-homology domain (PH domain) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000016695   Gene: ENSCAFG00000011344   Transcript: ENSCAFT00000018028
Sequence length 374
Comment pep:known_by_projection chromosome:CanFam3.1:6:15921926:15973627:1 gene:ENSCAFG00000011344 transcript:ENSCAFT00000018028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKERRRAVLELLQRPGNARCADCGAPDPDWASYTLGVFICLSCSGIHRNIPQVSKVKSV
RLDAWEEAQVEFMASHGNDVARDTYESKVPPFYYRPTFSDCQLLREQWIRAKYERQEFTH
PDKQEPYSAGYREGFLWKRGRDNGQFLSRKFVLTEREGSLKYFNRNDAKEPKAVMKIEHL
NATFQPAKIGHPHGLQVTYLKDNSTRNIFVYHEDGKEIVDWFNALRAARFHYLQVAFPGA
SDADLVPKLSRNYLKEGYMEKTGPKQTEGFGKRWFTMDDRRLMYFKDPLDAFARGEVFIG
SRESGYTVLDGLPPSTQGHHWPHGITIVTPERRFLLACETETEQRAWVEAFRKVVDRPML
PQEYAVEAHFKHKP
Download sequence
Identical sequences E2R2R3
ENSCAFP00000016695 XP_848516.1.84170 ENSCAFP00000016695 9615.ENSCAFP00000016695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]