SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000016753 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000016753
Domain Number 1 Region: 1945-2180
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-54
Family DBL homology domain (DH-domain) 0.0000374
Further Details:      
 
Domain Number 2 Region: 2180-2304
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-31
Family Pleckstrin-homology domain (PH domain) 0.0028
Further Details:      
 
Domain Number 3 Region: 1742-1815
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000209
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.019
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000016753
Domain Number - Region: 161-227
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000424
Family Ankyrin repeat 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000016753   Gene: ENSCAFG00000011376   Transcript: ENSCAFT00000018087
Sequence length 2785
Comment pep:known_by_projection chromosome:CanFam3.1:3:49111129:49308165:1 gene:ENSCAFG00000011376 transcript:ENSCAFT00000018087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKQNKKRVSLYGDCVVTVLLAEEDKVEDDVVFYLVFSGSTLYHCTSTRKVSGDTLETIAP
GHDCCETVKVLLCASKEGLPVFVVAEEDFHFIQDEAYDAAQFLATSAGNQQALNFTRFLD
RSGPPSGDVNSLDEKVALAFRHLKLPAEWNVLGTDQTLHGTDGSPRETLMHFAVRLGLLR
LTWFLLQKPGGRGALSIHNQEGATPVSLALERGYHKLHQLLTQENAEEPDSWSSLSYEIP
YGDCSVRHHRELDVYTLTSESKSHHEPSVPGNSCTGHIFKLMNIQQQLMKTNLKQMDNPM
PLMVTAQDPSSVPSAQDSDGQFLCCTSDPRDSQLHSSLPEDPESSPCAQGSTVGEIEGSS
DFSCVAKEENTDCSCKKETKGVEKEGEEAEPSLTVDCGTMSDPSSHRPSMPACGGKGMGT
LPPCGIRNGETGTKSSALATDQVSLDTGDSVLQGDVGMQPATAPTQHFSGCELAAGIPVT
PGEMESGPVNAHAAIQKNVLEVRESTKEKLENSNIITDGSSDVKVTSQTADKASVPNCVS
ATSSPDGDKPAESLLAFSNGEASPVKTAETEASRSCEGSAGAPMDQSSLVIPAAAEDTTS
DGLELYAPLTGTSEAASSSDLTFPGPQKDAPNQKSEPESSHIQSQTSRSPICSTTRGGTP
CAAFACGQSSVTSSGMLAAEYCDGIVTQPESTTPGLPPTQHPPLTLCCEGPQANAATPGP
MRDTQEQVEFCPVEVSDKKGQGEDLKLGTSSTNMLEVHPQAVVPKAKKELVPDQAVTSDK
TFSLASSPGSESVTKDDALFLFPSQKEKGIATPELHTAADGRDGPGRDSNDPDKQPLEDG
ATGLSTPSLAVQLQPSMGNTSPMGLGGEHGSVCLSAAPEVLDIKGAADSSLLCAGKAIMA
SDSILTEEGKNLVVPESSEAQGQDGRDKAAACSFLKEDTHSSGTFQEEQRTPPPGQEALG
FCGEPGSAACAEERALERGNSLGTPSACLNAETEHNKEVAPPVSLLTEGGAAQSLVPLGA
SLAADPSQEALGAEQSSSALLPDLLPDGSEALSRNGSFALDVGVQNPESQGKNTAHEVSG
NVQLDVAVVNALQGNAGARRKAILHNAQDLPIPEVLSQEKNMILGLPGALADEGVTDLQG
AAAPEMVPLRGKERDNNCGLANSGKAQVDPEAHHILEQPLAKELPTETGLSSSGDQALGR
ARGTPLLPCAVPLPKGADSIEETACRIVEAVLDQVRFSGALITGREIGHMSLSRPSESDP
VTEQPEGASTGQVSTFLPVQTVHMGSICEEAPGNCAGYLAETEEPEKMVLPTEGSEPATD
MPDLKAADEVDFLSNIGVSSASTEVAVKDTATPPDMKQGLMTQAINRESWCTIKPCPDAT
SLLAPAQSPECENFLDVGLSRECASKQGVLKRESGSDSDLFHSPSEEVDSIIFPKPEEEQ
LVCDITGSSSSTDDTASLDRHSSHGSDVSLPQISNLNRSRDQQCLDGFYSHGVGAEGRES
EGEAAGSGEMEEEEMDSITEVPANCSVLRSSMRSLSPFRRHSWGPGKNAASDAEMNQRSS
LRVLGDVVRRPPIHRRSFSLEGLTGGAGVGNKPSSSLDVNSINTKELRHPFNGEERGDSL
VSLSEEDLESGQREHRMLDQQACHRSKQQGFNYCTSAISSPLTKSISLMTISHPGLDHSR
PFHSTSANLTESITEETYSFLPQSPSKKDFEGKSGTKVSRTFSYIKNKMSSSKKSREKEK
EKEKIKEKEKDLKEKDKKTINGHTFSPIPVVGPISCSQCVKPFTSKDAYTCAGCSAFVHK
GCRESLASCAKVKMKQPRGSLQAQDTSSLPTVIMRSKPSQPKERPRSAVLLADEATAIPM
FANRRSQQSISLSKSVSIQNIAGVGNDENISNTWKFLSHSTDSLNKISKVNESTESLTDE
GVGTDMNEGQLMGDFEMESKQLEAESWSRVVDSKFLKQQKKDVVKRQEVIYELMQTELHH
IRTLKIMSDVYSRGMMTELLFEQQTVEKLFPCLDELISIHSQFFQRILERKKESLVDKSE
KNFLIKRMGDVLVNQFSGENAERLKKTYGKFCGQHNQSVNYFKDLHTKDKRFQAFVKKKM
SSAVVRRLGIPECILLVTQRITKYPVLFQRILQCTKDNEVEQEDLAQSLSLVKDVIGAVD
SKVASYEKKVRLNEIYTKTDSKSIMRMKSGQMFAKEDLKRKKLVRDGGVFLKSAAGRLKE
VQAVLLTDILVFLQEKDQKYVFASLDQKSTVISLKKLIVREVAHEEKGLFLISMGMKDPE
MVEVHASSKEERNSWIQIIQDAINTLNRDEDEGIPSENEEEKRILDTKARELKEQLQQKD
QQILLLLEEKEMIFRDMTECSTPLPEDCSPTHSSRILFRSNTEEALKGGPLMKSAINEVE
ILQGLVSGSLGGTLGPAVSSPVEQEGIVGPVSLPRRAETFGGFDSHQMNASKGGEKEEGE
DGQDLRRTESDSGLKKGGNANLVFMLKRNSEQLVQSVIHLHELLSTLQGVVLQQDSYIED
QKLLLAERALTRSSSRPSSLVEQEKQRSLEKQRQDLANLQKQQAQHLEEKRRREREWEAR
ERALQEREARLAQREQDVWRGQQDLDREREELQHKKGAYQCDLERLRTAQKQLEREQEQL
KRDAERLSQRQVEHDACQVSYQHTKLLRIPSFFPNPEEPPMPSVPSIAKSGSLDSELSVS
PKRNSISRTHKDKGPFHILSSTSQTNKVPEGQSQTPVPASASTRLFGLAKPKEKKEKKKK
NKGSRSQPCDGPGSEVPTEGEEIFC
Download sequence
Identical sequences F1Q074
ENSCAFP00000016753 ENSCAFP00000016759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]