SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000016769 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000016769
Domain Number 1 Region: 3-139
Classification Level Classification E-value
Superfamily PX domain 4.32e-41
Family PX domain 0.000000173
Further Details:      
 
Domain Number 2 Region: 218-332
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-25
Family SH3-domain 0.0000012
Further Details:      
 
Domain Number 3 Region: 147-216
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-19
Family SH3-domain 0.0000323
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000016769   Gene: ENSCAFG00000011395   Transcript: ENSCAFT00000018106
Sequence length 391
Comment pep:known chromosome:CanFam3.1:6:5700832:5719439:-1 gene:ENSCAFG00000011395 transcript:ENSCAFT00000018106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWHDLSEKVVYRRFTEIYEFHKMLKEMFPI
EAGDINPENRIIPHLPAPRWFDGQRAAESRQGTLTEYYNTLMGLPVKISRCPQLLDFFRV
RPDDLKLPTDSQVKKPETYLVPKDGKSSVTDITGPIILQTYRAIADFEKTSSSQMALATG
DVVDVVEKSESGWWFCQTKTKRGWVPASYLEPLDSPDEAEDPEPNYEGEPYVTIKAYTAE
MEDEMSLQEGEAIEVIHKLLDGWWVVRKDDITGYFPSMYLQKSGQDAAQAHRQIKSRGAP
PRRSSIRNAHSIHQRSRKRLSQDTYRRNSVRFLQQRRRQARPGPRSPGSPREEQPATQPA
KPQPAVPPRPSADLILHRCSESTKRKLASSV
Download sequence
Identical sequences F1Q058
XP_849574.2.84170 ENSCAFP00000016769 ENSCAFP00000016769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]