SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000017015 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000017015
Domain Number 1 Region: 430-486
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-22
Family SH3-domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000017015   Gene: ENSCAFG00000011559   Transcript: ENSCAFT00000018370
Sequence length 487
Comment pep:known_by_projection chromosome:CanFam3.1:33:24901444:24925744:-1 gene:ENSCAFG00000011559 transcript:ENSCAFT00000018370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNK
VSEEHDILKKKEMESGPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAARGF
GGKYGVEKDRADKSAVGFDYKGEVEKHASQKDYSHGFGGRYGIEKDKRDKAALGYDYKGE
TEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGARGLKA
KFESMAEEKRKREEEEKAQQIARQQQERKALKKMSHEAQQPVNTVREPEVPAPLPKKISS
DAWPPAGSSPSSEPEPVRTSAERPVPALPLLQNPPEDEEPPALPPRTLEGLQLEEEPVYE
AEPEPEPEPKPEPEPEPTAEPENDYEDVGDIDIREEDGEADGDYEDVLEVQSPSCPTPAE
SSGYPAGTGAGISAIALYDYQGEGSDEISFDPDDIITDIEMVDEGWWRGRCHGHFGLFPA
NYVKLLQ
Download sequence
Identical sequences E2R7N4
XP_005639607.1.84170 ENSCAFP00000017015 ENSCAFP00000017015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]