SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000017037 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000017037
Domain Number 1 Region: 180-341
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.35e-47
Family CRAL/TRIO domain 0.0000732
Further Details:      
 
Domain Number 2 Region: 85-169
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00000000000000262
Family CRAL/TRIO N-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000017037   Gene: ENSCAFG00000011594   Transcript: ENSCAFT00000018394
Sequence length 357
Comment pep:known_by_projection chromosome:CanFam3.1:3:52260877:52278803:-1 gene:ENSCAFG00000011594 transcript:ENSCAFT00000018394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISRGPSTFLQPSLGGGCLERPGRKRGPSFSEDSESPRGSMSEGVGTFRVVPEEEQELRA
QLERLTTKDHGPVFGPCSQLPRHTLQKAKDELNEREETREEVVRELQELVQAQAATGQEL
ARAVAERVQGRDSAFFLRFIRARKFHVGRAYELLRGYVNFRLQYPELFDSLSLEAVRCTV
EAGYPGVLPSRDKYGRVVMLFNIENWDSEEITFDEILQAYCFILEKLLENEETQINGFCI
IENFKGFTMQQAAGLRASDLRKMVDMLQDSFPARFKAIHFIHQPWYFTTTYNMVKPLLKN
KLLQRVFVHGDDLSGFFQEIDEDILPADFGGTLPKYDGKVVAEQLFGPRAQAENTAF
Download sequence
Identical sequences E2R7K7
ENSCAFP00000017037 XP_005618409.1.84170 XP_013967890.1.84170 ENSCAFP00000017037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]