SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000017041 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000017041
Domain Number 1 Region: 219-439
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-54
Family DBL homology domain (DH-domain) 0.000078
Further Details:      
 
Domain Number 2 Region: 430-567
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-19
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 
Domain Number 3 Region: 565-639
Classification Level Classification E-value
Superfamily SH3-domain 8.27e-17
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000017041   Gene: ENSCAFG00000011587   Transcript: ENSCAFT00000018398
Sequence length 675
Comment pep:known_by_projection chromosome:CanFam3.1:25:44471741:44577670:-1 gene:ENSCAFG00000011587 transcript:ENSCAFT00000018398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MREHTTPTNQEMQGREPRGSTPIQRNSIFNRTMRQRSKGKAKDTPEQNTHHPADSLENGQ
SVNEPLTLNSPQSRMLRWRIPKQPDPGAKRTSESSSTPGNGATPEECPALADSPTTLTEA
LQMIHPIPADSWRNLIEQIGLLYQEYRDKSTLQEIETRRQQDAEIHTNAHGSPASEETPE
EEEDEEEEEDEPASPPERKALPQICLLSNPHSRFNLWQDLPEIQSSGVLEILQPEEIKLQ
EAMFELVTSEASYYKSLSLLVSHFMENERLKKILHPSEAHILFSNVLDVMAVSERFLLEL
ERRMEENIVISDVCDIVYHYAANHFSVYITYVSNQTYQERTYKQLLQEKAAFRELIAQLE
LDPKCRGLPLSSFLILPFQRITRLKLLIQNILKRVEERSERECTALEAHKELEMVVKACN
EGVRKMSRTEQMISIQKKMEFKIKSVPIISHSRWLLKQGELQQMSGPKTSRTLRTKKLFR
EIYLFLFNDLLVICRQIPGDKYQVFDSAPRGLLRVEELEDQGQTLANVFILRLLENADDR
EATYMLKASSQSEMKRWMTSLAPNRRTKFVSFTSRLLDCPQVQCVHPYVAQQPDELTLEL
ADILNILEKTEDGWIFGERLHDQERGWFPSSMTEEILNPKIRSQNLKECFRVHKMDDPQR
SQNKDRRKLGSRNRQ
Download sequence
Identical sequences F1PFV4
ENSCAFP00000017041 ENSCAFP00000017041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]