SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000017118 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000017118
Domain Number 1 Region: 145-476
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.57e-87
Family Protein kinases, catalytic subunit 0.0000000000147
Further Details:      
 
Domain Number 2 Region: 1-142
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.35e-38
Family Regulator of G-protein signaling, RGS 0.000000481
Further Details:      
 
Domain Number 3 Region: 512-620
Classification Level Classification E-value
Superfamily PH domain-like 1.64e-24
Family Pleckstrin-homology domain (PH domain) 0.00000503
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000017118   Gene: ENSCAFG00000011603   Transcript: ENSCAFT00000018482
Sequence length 646
Comment pep:known_by_projection chromosome:CanFam3.1:26:19408466:19506619:1 gene:ENSCAFG00000011603 transcript:ENSCAFT00000018482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKYLQERNEITFDKIFNQKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLENEEDRL
CRSRQIYDTYIMKELLSCSHPFSKQAVEHVQSHLSKKQVTSTLFQPYIEEICESLRGNIF
QKFMESDKFTRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCL
DKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYH
LSQHGVFSEKEMRFYATEIILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDF
SKKKPHASVGTHGYMAPEVLQKGAAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEI
DRMTLTVNVELPEAFSPELRSLLEGLLQRDASKRLGCHGGGAQEVKEHIFFKGIDWQHVY
LQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDCDQDLYKNFPLVISERWQQEVA
ETVYEAVNADTDKIEARKRAKNKQLGHEEDYALGKDCIMHGYMLKLGNPFLTQWQRRYFY
LFPNRLEWRGEGESRQNLLTMEQILSVEETQIKDKKCILLRIKGGKQFVLQCESDPELVQ
WKKELTETFTEAQRLLRRAPKFLNKSRSSVVELSKPPLCHRSSNGL
Download sequence
Identical sequences F1PF32
ENSCAFP00000017118 ENSCAFP00000017118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]