SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000017132 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000017132
Domain Number 1 Region: 203-544,625-646
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.36e-76
Family Myotubularin-like phosphatases 0.0000165
Further Details:      
 
Domain Number 2 Region: 48-180
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000332
Family GRAM domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000017132   Gene: ENSCAFG00000011652   Transcript: ENSCAFT00000018499
Sequence length 700
Comment pep:known_by_projection chromosome:CanFam3.1:17:59215317:59222855:-1 gene:ENSCAFG00000011652 transcript:ENSCAFT00000018499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWWGGRGQSFNIAPQKVEPDLGLSGPKSVQRTGMLEPRSCQLSSHLASGCLPGEQILAWA
PGVRKGLEPELPGTLICTNVRVTFQPCGWQRSQETPLSSEYDFALVNIGRLEAVNGLSRV
QLLRPGSPLKFIPEEILIHGRDFRLLRVAFEAGGLEPQAFQVTMAIVQARARSSQAQQYA
GIPLSKAGQSSGSRKPPIPLLETSEDWETERKKQGAKSWRVSTVNERFDVATSLPRYFWV
PKRTLDSEVRRAFGHFHQGRGPRLSWHHRGGSDLLRCGGFYTASDPNKEDIRAVESMLQA
GHSDVVLVDTVDELPTLADVQLAHLKLRALCLPDSSAAEEKWLSALEGTRWLDYVRSCLR
KASDISVLVTSRVRSIVLQERGDRDFNGLLSSLVQLLSVPEARTLLGFQSLVQREWVAAG
HPFLTRLGVTGASEEAPVFLLFVDCVWQLLQQFPAEFEFSEFFLLALHDSARVPDTLTFL
RDTPWERGKQSGQFNSYTQIYTPGYSQTPAGNSANPQLSVWDWDLRYSSEQILQFHNPGY
DPEHCPDSLLPRQQPSFMVPGPPNSVWLFSRGALTPLNQLCPWRDSPSLLAVSSRWLPRP
AISSESLADQEWGLPSHWGACPLPPGLLLPGYLGPQIKLWRRCYLRGRPEFQKGLSAPTI
SGLQDELSHLQELLRKWTPRVSPEDHSKKRDPNTILSQSR
Download sequence
Identical sequences E2R1T1
ENSCAFP00000017132 XP_005630796.1.84170 9615.ENSCAFP00000017132 ENSCAFP00000017132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]