SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000017204 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000017204
Domain Number 1 Region: 10-235
Classification Level Classification E-value
Superfamily Kelch motif 1.7e-53
Family Kelch motif 0.00034
Further Details:      
 
Domain Number 2 Region: 242-340
Classification Level Classification E-value
Superfamily Kelch motif 2.62e-19
Family Kelch motif 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000017204   Gene: ENSCAFG00000011693   Transcript: ENSCAFT00000018574
Sequence length 354
Comment pep:known_by_projection chromosome:CanFam3.1:20:40023411:40026543:-1 gene:ENSCAFG00000011693 transcript:ENSCAFT00000018574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGGGRAFAWQVFPPMPTCRVYGTVAYQDGHLLVLGGCGRAGLPLDTAETLDMASHTWL
ALAPLPTARAGAAAVVLGKQVLVVGGVNEGQSPVAAVEAFLADEGRWERRATLPQAAMGV
ATVERDGMVYALGGMGPDTAPQAQVRVYEPRRDCWLSLPSMPTPCYGASTFLHGNKIYVL
GGRQGKLPVTAFEAFDLEACTWTRHPSLPSRRAFAGCAMAEGNVFSLGGLQQPGPHNFYS
RPHFVNTVEMFDLEHGSWTKLPRSLRMRDKRADFVVGSLGGHIMAIGGLGNQPCPLGSVE
GFSLARRRWEALPTMPTARCSCSSLQAGSRLFVIGGVAQGPSQAVEALCLRDGV
Download sequence
Identical sequences E2QWY0
9615.ENSCAFP00000017204 XP_013977692.1.84170 XP_541887.2.84170 ENSCAFP00000017204 ENSCAFP00000017204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]