SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000017222 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000017222
Domain Number 1 Region: 533-859
Classification Level Classification E-value
Superfamily DNase I-like 5.76e-56
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0000555
Further Details:      
 
Domain Number 2 Region: 162-250
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000107
Family SH2 domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000017222   Gene: ENSCAFG00000011650   Transcript: ENSCAFT00000018592
Sequence length 1335
Comment pep:known_by_projection chromosome:CanFam3.1:25:44611670:44732137:1 gene:ENSCAFG00000011650 transcript:ENSCAFT00000018592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRGLDWTVPPAPNFAGLRGGRAVAQREAQGEGRPDGAGTRVGGPCRRASCAPVTCGRPG
PPPRPPARRRPREARGGVGRWSSLPALSQGGSSRGRRLPLPRRAPEQEVAGRAGLHRAAG
GAARGAARGPRLPSEARARGAGRPPEARHGPLLEPRQHHPLQGQELLSRTGKKRIFFVRA
RDSISRAYALCVLYRNCVYTYRILPNEDDKFTVQASEGVPMRFFTKLDQLIEFYKKENMG
LVTHLQYPVPLEEEDAGDEPEEETEGVLSPPELPPRNIPLSAGLCEAKEVPLLSENLRAT
EVSRPSFSETLFQRLQSMDTSGLPEEHLKAIQDYLSTQLALDSDFVKTGSSSLPHLKKLT
MVLCKDLYGEVIRTLPSLESLQRLFDQQLSPGLRPRPQVPGEANPINMVAKLSQLTSLLS
SIEDKVKALLHEGPESPHRRSLIPPVTFEVKSESLGIPQKLQLKVDVESGKLIIKKSKDG
SEDKFYTHNKILQLIKSQKFLNKLVILVETEKEKTLRKEYVFADSKKREGFCQLLQQMKN
KHSEQPEPDMITIFIGTWNMGNAPPPKKITSWFLSKGQGKTRDDSADYIPHDIYVIGTQE
DPLGEKEWLEILKHSLQEITSMTFKTIAIHTLWNIRIVVLAKPEHENRISHICTDNVKTG
IANTLGNKGAVGVSFMFNGTSLGFVNSHLTSGSEKKLRRNQNYMSILRFLALGDKKLSPF
NITHRFTHLFWLGDLNYRVELPTWEAETIVQKIKQQQYADLLSHDQLLMERKEQKVFLHF
EEEEITFAPTYRFERLTRDKYAYTKQKATGMKYNLPSWCDRVLWKSYPLVHVVCQSYGST
SDIMTSDHSPVFATFEAGVTSQFVSKNGPGTVDSQGQIEFLRCFATLKTKSQTKFYLEFH
SSCLESFVKSQEGENEEGSEGELVVKFGETLPKLKPIISDPEYLLDQHILISIKSSDSDE
SYGEGCIALRLEATETQLPIYTPLTHHGEMTGHFRGEIKLQTSQGKMREKLYDFVKTERD
ESSGTKSLKSLTSHDPMKQWEPANRVPPCSGTNITEIINPNYMGVVPFGHMKQSLSPDQQ
PTAWSYDQPLKDSSLGPGRGESPPTPPSQPPVSPKKFSSSTATRGPCPRTQESRPCDLGK
STPESSPQEDVRLTKPEMFENPLYGSVSSFPKLLPRKEQESPKMLRKDPPPCPDPGILSP
GILLPKAQEAEGTKGTGKAAAAAPFLSPTPRLRSYTCSSSAEGRPAAADKSQGKAKAAAG
LQAQVPAKRPIKPSRSELSQQPPPPPAQRPPLPVKSPAVLHLQHSKGRDYRENAELPHHG
KLRAEDAPLGRASMQ
Download sequence
Identical sequences F1PEA8
ENSCAFP00000017222 ENSCAFP00000017222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]