SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000017324 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000017324
Domain Number 1 Region: 187-533
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.1e-86
Family Protein kinases, catalytic subunit 0.00000000000276
Further Details:      
 
Domain Number 2 Region: 30-184
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.21e-41
Family Regulator of G-protein signaling, RGS 0.0000000415
Further Details:      
 
Domain Number 3 Region: 554-664
Classification Level Classification E-value
Superfamily PH domain-like 9.59e-27
Family Pleckstrin-homology domain (PH domain) 0.00000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000017324   Gene: ENSCAFG00000011733   Transcript: ENSCAFT00000018700
Sequence length 689
Comment pep:known_by_projection chromosome:CanFam3.1:18:50148506:50167485:-1 gene:ENSCAFG00000011733 transcript:ENSCAFT00000018700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFS
QKLGYMLFRDFCLKHLEEAKPLVEFYEEIKKYEKLETEEERLARSREVFDTYIMKELLAC
SHPFSKSATEHVQGHLVKKQVPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEADMRFYAAE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPE
LRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRMEARK
KTKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSL
LTMEEIQSVEETQIKERKCLLLKIRGGKQFVLQCDSDPELVQWKKELRDAYREAQQLVQR
VPKMKNKPRSPVVELSKVPLVQRGSANGL
Download sequence
Identical sequences E2R5J6
ENSCAFP00000017324 XP_852085.1.84170 ENSCAFP00000017324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]