SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000017348 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000017348
Domain Number 1 Region: 332-556
Classification Level Classification E-value
Superfamily Cullin repeat-like 1.99e-60
Family Exocyst complex component 0.0012
Further Details:      
 
Domain Number 2 Region: 182-289
Classification Level Classification E-value
Superfamily PH domain-like 1.98e-28
Family Pleckstrin-homology domain (PH domain) 0.00000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000017348   Gene: ENSCAFG00000011797   Transcript: ENSCAFT00000018726
Sequence length 727
Comment pep:known_by_projection chromosome:CanFam3.1:4:8133670:8135853:1 gene:ENSCAFG00000011797 transcript:ENSCAFT00000018726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMAMSDSGASRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRIQALAEETAQNLK
RNVYQNYRQFIETAREISYLESEMYQLSHLLTEQKSSLESIPLTLLPAAAAAAAGAAAAS
GGEEGGGGAGGRDHLRGQAGFFPAPGGASRDSSGPGEEGKQRTLTTLLEKVEGCRHLLET
PGQYLVYNGDLVEYEADHMAQLQRVHGFLMNDCLLVATWLPQRRGMYRYNALYPLDGLAV
VNVKDNPPMKDMFKLLMFPESRIFQAENAKIKREWLEVLEETKRALSEKRRREQEEAAAP
RGPPQVTSKAGNPFEDEEEDEPATPEVEEEKVDLSVEWIQELPEDLDVCIAQRDFEGAVD
LLDKLNHYLEDKPSPPPVKELRAKVDERVRQLTEVLVFELSPDRSLRGGPKATRRAVSQL
IRLGQCTKACELFLRNRAAAVHTAIRQLRIEGATLLYIHKLCHVFFTSLLETAREFETDF
AGTDSGCYSAFVVWARSAMGMFVDAFSKQVFDSKESLSTAAECVKVAKEHCQQLGDIGLD
LTFIIHALLVKDIQGALHSYKEIIIEATKHRNSEEMWRRMNLMTPEALGKLKEEMKSCGV
RNFEQYTGDDCWVNLSYTVVAFTKQTMGFLEEALKLYFPELHMVLLESLVEIILVAVQHV
DYSLRCEQDPEKKAFIRQNASFLYETVLPVVEKRFEEGVGKPAKQLQDLRNASRLIRVNP
ESTTSVV
Download sequence
Identical sequences E2R5F1
XP_005618878.1.84170 ENSCAFP00000017348 9615.ENSCAFP00000017348 ENSCAFP00000017348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]