SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000017479 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000017479
Domain Number 1 Region: 133-245
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-33
Family Phosphotyrosine-binding domain (PTB) 0.00000707
Further Details:      
 
Domain Number 2 Region: 12-111
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000352
Family Phosphotyrosine-binding domain (PTB) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000017479   Gene: ENSCAFG00000011874   Transcript: ENSCAFT00000018862
Sequence length 309
Comment pep:known_by_projection chromosome:CanFam3.1:24:40199127:40281988:1 gene:ENSCAFG00000011874 transcript:ENSCAFT00000018862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNSSFNVGLHLGFVFRIDSYSLKIYQRCWLVFKKASSKGPKRLEKFSDERAAYFRCYHKV
TELNNVKNVARLPKSTKKHAIGIYFNDDTSKTFACESDLEADEWCKVLQMECVGTRINDI
SLGEPDLLATGVEREQSERFNVYLMPSPNLDVHGECALQITYEHICLWDVQNPRVKLISW
PLSALRRYGRDAAWFTFEAGRMCETGEGLFIFQTRDGEAIYQKVHSAALAIAEQHERLLQ
SVKNSMLQMKMSERAASLSTMVPLPRSAYWQHITRQRSAGQLCRLQGKDVSSPLKLHRTE
TFPAYRSEH
Download sequence
Identical sequences F1PHC2
9615.ENSCAFP00000017479 ENSCAFP00000017479 ENSCAFP00000017479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]