SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000017519 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000017519
Domain Number 1 Region: 20-237
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.04e-48
Family Ankyrin repeat 0.00016
Further Details:      
 
Domain Number 2 Region: 250-292
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000106
Family SOCS box-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000017519   Gene: ENSCAFG00000011901   Transcript: ENSCAFT00000018906
Sequence length 293
Comment pep:known_by_projection chromosome:CanFam3.1:X:11506036:11533016:-1 gene:ENSCAFG00000011901 transcript:ENSCAFT00000018906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGKPPGGTSKSLRPGGPPDTRLLSNPWMGDIVSDWSPVHEAAIHGRLLSLRNLIGQGWP
VNLVTADRVSPLHEACLGGHPSCANILLKHGAQVDGVTTDWHTPLFNACVSGSQDCVNLL
LQHGASPHAVSDLASPIHEAAKRGHVECLETLAAHGGDVDYNISHLGTPLYQACENQQVA
CAKKLLESGASVNQGRGLDSPLHVVARASSRELALLLMDFGADTQAKNAEGKRPLELVPP
ESPLTQLFLQREGPPSLLQLCRLRIRKCFGTQQHHKINGLVLPEELKRFLLHM
Download sequence
Identical sequences E2QRR4
9615.ENSCAFP00000017519 XP_537962.2.84170 ENSCAFP00000017519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]