SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000017760 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000017760
Domain Number 1 Region: 30-473
Classification Level Classification E-value
Superfamily Serpins 7.72e-69
Family Serpins 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000017760   Gene: ENSCAFG00000012068   Transcript: ENSCAFT00000019154
Sequence length 477
Comment pep:known_by_projection chromosome:CanFam3.1:4:8680833:8694324:1 gene:ENSCAFG00000012068 transcript:ENSCAFT00000019154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPAGVSLVVTVLCLLAGAGLAAGDRVYIHPFHLLVYSKSSCEQLEKSNTEMPKDLTFLP
VPIQAKTSPVDEEALREELVLVSERLEGEDKMRATKVGMMLNFLGFHMYRMLSESQNAAS
GTILSPTTLFGTLASFYLGALDPTASRLQAFLGVPGEDQGCTSRLDGHKVLSALQTIQSL
LVAQGGASGQSTPLLSTVVGLFTAPGLRLKQPFVRALAPFAPITFPRSLDLSMDPDLAAE
KINRFMQAVTGWRMDRPMSGISPDSTLLFNTYVHFQGKLKGLSPLAGLREFWVDNTTSVS
VPMLSGTGTFQHWSDPQSNLSMTRVPLGKSACLLLVRPLSTWGLQTVEALTFQHNFPTWV
KNLSPRAIRLTMPQLTLRGSYDLQDLLAQAKLPTLLGAEANLGKISDDNVRVGKVLNSIL
LELQADQEEQPTESAPQPDGPEVLEVTLDHPFLFAIYEQESTALHLLGRVANPLSGV
Download sequence
Identical sequences F1PAL5
ENSCAFP00000017760 ENSCAFP00000017760 XP_005618890.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]