SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000017866 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000017866
Domain Number 1 Region: 612-724
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.2e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00047
Further Details:      
 
Domain Number 2 Region: 68-237
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.72e-34
Family G proteins 0.00000182
Further Details:      
 
Domain Number 3 Region: 344-409,552-597
Classification Level Classification E-value
Superfamily PH domain-like 3.97e-17
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 4 Region: 736-827
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.11e-16
Family Ankyrin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000017866   Gene: ENSCAFG00000012092   Transcript: ENSCAFT00000019261
Sequence length 857
Comment pep:novel chromosome:CanFam3.1:25:46449278:46972782:1 gene:ENSCAFG00000012092 transcript:ENSCAFT00000019261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYQQQLANSAAIRAEIQRFESVHPNIYSIYELLERVEEPVLQNQIREHVIAIEDAFVNS
QEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLL
LIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRMANYRNTSEIPLVLVGTQD
AISSTNPRVIDDARARKLSSDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSI
GPCKSLPNSPSHSSVCSAQVSAVHISQTSNGGGSLSDYSSSVPSTPSTSQKELRIDVPPT
ANTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQGMLLKRSGKS
LNKEWKKKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRATSACAPI
SSPKTNGLSKDMSSLHISPNSGNVTSASGSQMASGVSLGSFSGRPDGMQQRSYSVSSADQ
WSEATVIANSAISSDTGLGDSVCSSPSISSTTSPKLDPPPSPHANRKKHRRKKSTSNFKA
DGLSGTAEEQEENFEFIIVSLTGQTWHFEATTYEERDAWVQAIESQILASLQSCESSKNK
SRLTSQSEAMALQSIRNIRGNSHCVDCDTQNPNWASLNLGALMCIECSGIHRNLGTHLSR
VRSLDLDDWPIELIKVMSSIGNELANSVWEESSQGRTKPSLDSTREEKERWIRAKYEQKL
FLAPLPCTELSLGQHLLRATADEDLRAVILLLAHGSREEVNETCGEGDGRTALHLACRKG
NVVLAQLLIWYGVDVMARDAHGNTALAYARQASSQECIDVLLQYGCPDERFVLMATPNLS
RKNNNRNNSSGRVPTII
Download sequence
Identical sequences F1P7C6
XP_005635968.1.84170 ENSCAFP00000017866 ENSCAFP00000017866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]