SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000017950 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000017950
Domain Number 1 Region: 79-125
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 7.37e-16
Family Transcriptional factor domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000017950
Domain Number - Region: 15-43
Classification Level Classification E-value
Superfamily RING/U-box 0.00108
Family RING finger domain, C3HC4 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000017950   Gene: ENSCAFG00000012186   Transcript: ENSCAFT00000019352
Sequence length 126
Comment pep:known_by_projection chromosome:CanFam3.1:35:26285784:26287582:1 gene:ENSCAFG00000012186 transcript:ENSCAFT00000019352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCAMDPAPSGSRFQSDLDFCPDCGSVLPLPGAQDAVTCVRCGFGVPVRDFEGKVVRTRIV
FNQVGTAVPAPVQEEPELQGPVVDRRCSRCGHEGMAYHTRQMRSADEGQTVFYTCTSCRF
QEKEDS
Download sequence
Identical sequences F1PIF7
ENSCAFP00000017950 ENSCAFP00000017950 9615.ENSCAFP00000017950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]