SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018058 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018058
Domain Number 1 Region: 19-257
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.8e-47
Family Nuclear receptor ligand-binding domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018058   Gene: ENSCAFG00000012261   Transcript: ENSCAFT00000019466
Sequence length 279
Comment pep:known_by_projection chromosome:CanFam3.1:2:73233702:73237237:1 gene:ENSCAFG00000012261 transcript:ENSCAFT00000019466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSQPGTCPCQGAAGRPAILYALLSPSLTARPPVPPVQSRCLCRQHRPVRLCAPHRTCR
EALDVLARTVVFLKNLPSFCQLPPQDQQLLLRVCWGPLFLLGLAQDTVTFEVAEAPVPSI
LKKILLEEPSSGAHSGQLPDRPQPSLAAVQWLQCCLESFWSLELGPKEYAYLKETILFNP
GLPGLHASSHIGHLQEEAHHALCEALEPWCPAGQGRLARVLLTASTLKSIPPSLLGDLFF
RPIVGDIDIAGLLEDMLLLSQPVPAQAEIKWRLGKGWQH
Download sequence
Identical sequences F6V4A2
ENSCAFP00000018058 ENSCAFP00000018058 XP_005617781.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]