SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018116 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018116
Domain Number 1 Region: 649-707
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000351
Family SAM (sterile alpha motif) domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000018116
Domain Number - Region: 343-377
Classification Level Classification E-value
Superfamily WWE domain 0.00706
Family WWE domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018116   Gene: ENSCAFG00000012270   Transcript: ENSCAFT00000019531
Sequence length 1005
Comment pep:known_by_projection chromosome:CanFam3.1:28:30007703:30046528:1 gene:ENSCAFG00000012270 transcript:ENSCAFT00000019531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERKPNGGGGAASTSSSGTNLLFSSSATEFSFNVPFIPVTQAAAVSASLLLPGEDSTDV
GEEDSFLGQTSAHTSTPQTFSYFSQVSSSSDPFGNIGQSPLTTVATSAGHSAFSKSPAAL
PFTTGSQDVLNACSPSISKAQYGAPPSSQMGMNTYLPSQPSSLPPSNFGSPPQGTPQQGH
NPYRHTPVSSRANPYIAPPQLQQCHTQGHPTHPPPPGPPVQMYQMPVGSLPPIPPSVPSG
LSPPTQQQALARPAGPSVHAPPFLLQNQYEPVQPHWFYCKEVEYKQLWMPFSVFDSLNLE
EIYNSVQPDPESVVLGTDGGRYDVYLYDRVRKAVYWEEEPAEVRRCTWFYKGDTDSRFIP
YTEEFSEKLEAEYKKAVTTNQWHRRLEFPSGETIVMHNPKVIVQFQPSSVPDEWGTTQDG
QTRPRVVKRGIDDNLDEIPDGEMPRVDHLVFMVHGIGPVCDLRFRSIIECVDDFRVVSLK
LLQTHFKKSLDDRKVSRVEFLPVHWHSSLGGDATGVDRNIKKITLPSIGRFRHFTNETLL
DILFYNSPTYCQTIVEKVRMEINRLHALFMSRNPDFKGGVSVAGHSLGSLILFDILSNQK
DLNLSKSPGPFAVANGVVKQPHFQEKQIPEEPKLTLDESCDLDIENEEVLSLQETLEALS
LSEYVSIFEKEKIDMESLLMCTVDDLKEMGIPLGPRKKIANFVKQKAVKLEQKKAASEKK
AVMAASTKGQEESGQKAKEMASLPSESNESKRKLPVGAYVSSVHVDYESFEVGTGQVSVV
YNSLDFEPEIFFALGSPIGMFLTIRGVDRIDENYRLPTCKGFFNIYHPLDPVAYRLEPMI
VPDLDLKAVLIPHHKGRKRLHLELKDSLSRMGSDLKQGFISSLKSAWQTLNEFARAHTSS
TQLQEELEKVAHQIKEEEEKQVVEAEKIVESPDFSKDEDYLGKVGMLNGGRRIDYVLQEK
PIESFNEYLFALQSHLCYWESEDTALLLLKEIYRTMNISPEQPQH
Download sequence
Identical sequences F1PQ80
ENSCAFP00000018116 ENSCAFP00000018116 XP_005637840.1.84170 XP_005637841.1.84170 XP_005637842.1.84170 XP_005637843.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]