SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018118 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018118
Domain Number 1 Region: 1296-1436
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-53
Family Phosphotyrosine-binding domain (PTB) 0.00000189
Further Details:      
 
Domain Number 2 Region: 173-301
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.98e-37
Family PLC-like (P variant) 0.0017
Further Details:      
 
Domain Number 3 Region: 7-169
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-29
Family Dual specificity phosphatase-like 0.00016
Further Details:      
 
Domain Number 4 Region: 1162-1283
Classification Level Classification E-value
Superfamily SH2 domain 1.05e-23
Family SH2 domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018118   Gene: ENSCAFG00000012301   Transcript: ENSCAFT00000019533
Sequence length 1442
Comment pep:known chromosome:CanFam3.1:16:345833:432969:1 gene:ENSCAFG00000012301 transcript:ENSCAFT00000019533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGRELDLTYITERIIAVSFPAGCSEESYLHNLQEVTRMLRSKHGDNYLVLNLSEKRYD
LTKLNPKILDVGWPELHAPPLDQVCTICKAQESWLNSDPQHVVVIHCRGGKGRIGVVISS
YMHFTNVSASADQALDRFAMKKFYDDKVSDLMQPSQKRYVQFLSGLLSGTVKMNASPLFL
HFVILHGTPNFDAGGACRPFLKLYQAMQPVYTSGIYNIGPETQSRIPIAIEPAQLLKGDI
MVKCYHKKYRSATRDVIFRLQFHTGAVQGYGLVFGKEDLDNASQDDRFPDNGKIELLFSA
TPEKIQGCEHLCNDHGVIVDFNTADPLIRWDSYESLGIGGEVSHTQGPVDGSLYAKVRKK
SASDPGVPSGPGPTASSPDHGDHTLSVSSDSGHSSASVRTDRTEEQPAAGPRRGLSPQEK
AELDQLLSGFGLDDPGSPLQDMTDAPGKYSGTRHVVPAQVHVNGDALLKDRETDILDDEM
PGHDLHSVDSIGTLSSSEGHQSAHLGPFAGHQSSQHSLLSDGFGSSPGDDAHGSLAPDLS
LGVDPVYEREQAFATREAKQPQPVLRRPSVSAQTQAYMQSGYSTQTWVRQQQMVAAHQYG
FTPDGEARLVGRSPEDRSSLGQAQSRVPVTPTRGSGSRVALQRGVGPTPHLPDAQRPPPG
KVLKPRFPDRVVNGTGPEPSADLAPGSPTLDIDQSIEQLNRLILELDPTFEPIPTHMNMP
GGQANGPVPPDSVGGGLRAGSLQDVGEAPSRGSVRPGSSGDEPLGGRFRKLSLGQYDNSA
GGQPAFPKCGWGKAPGAEQAASLAPFLSAADTKETVAPAYPPDPDGISGRTFFPAKSGSD
SSVSPTPAFPVSPETPYVTTPPHYLPFTPPGLQLGSASGLYRGAHEPRGCPEVLHRAVGM
SGSPVGPKSTALRADSPAAPAFQRAFTASCTITSSSPAQRRDSPSSGELLWVDGSPKATL
AVLGGGRQAGDLLSPSPDGPGRPHLPPTELQASFHNHQPSLVEPPEALGPPGGQAFLSFG
PGPMGGGLPPGEDPGALLANSHGAPQAPSTQGTAAAADNDGFLPHGFLTGTPGHGGHHSP
VLPGQSLALPGQPPLPEKKRASEGDRSAGSASPSSSGFSSPHSGSTMSIPFPNVLPDFPK
ALEAAAPSPDNPGDKHVSVNFVQDTSKFWYKADISREQAIAMLKDKEPGSFIVRDSHSFR
GAYGLAMKVATPPPSVLQLNKKAGDLANELVRHFLIECTPKGVRLKGCPNEPYFGSLTAL
VCQHSITPLALPCKLLIPDRDPLEEVADTSPQTAANSAAELLKQGAACNVWYLNSVEMES
LTGHQAVQKALSLTLVQEPPPMCTVVHFKVSAQGITLTDNQRKLFFRRHYPVSSVIFCAL
DPQDRKWITDGPCSRVFGFVARKQGSATDNVCHLFAEHDPEQPASAIVNFVSKVMIGSPK
KV
Download sequence
Identical sequences F1PQ78
ENSCAFP00000018118 ENSCAFP00000018118 XP_013975332.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]