SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018152 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018152
Domain Number 1 Region: 215-356
Classification Level Classification E-value
Superfamily PH domain-like 1.46e-42
Family Third domain of FERM 0.000000431
Further Details:      
 
Domain Number 2 Region: 107-214
Classification Level Classification E-value
Superfamily Second domain of FERM 1.06e-37
Family Second domain of FERM 0.000000679
Further Details:      
 
Domain Number 3 Region: 19-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-25
Family First domain of FERM 0.00000532
Further Details:      
 
Domain Number 4 Region: 503-581
Classification Level Classification E-value
Superfamily Moesin tail domain 1.31e-19
Family Moesin tail domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018152   Gene: ENSCAFG00000012307   Transcript: ENSCAFT00000019569
Sequence length 591
Comment pep:known_by_projection chromosome:CanFam3.1:26:22816823:22896294:1 gene:ENSCAFG00000012307 transcript:ENSCAFT00000019569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW
FFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFL
QVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMT
PEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALG
LHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLC
IGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRL
LQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTE
EEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEITTKPT
YPPMNPIPAPLPPDISSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLN
ELKTEIEALKLKERETALDILHNENSDRGGTSSKHNTIKKPQAQGRRPICI
Download sequence
Identical sequences E2RTM1
ENSCAFP00000018152 XP_005636481.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]