SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018181 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018181
Domain Number 1 Region: 1888-2178
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-71
Family Protein kinases, catalytic subunit 0.00000108
Further Details:      
 
Domain Number 2 Region: 494-673
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-52
Family DBL homology domain (DH-domain) 0.0000000134
Further Details:      
 
Domain Number 3 Region: 1135-1328
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.2e-50
Family DBL homology domain (DH-domain) 0.0000137
Further Details:      
 
Domain Number 4 Region: 680-800
Classification Level Classification E-value
Superfamily PH domain-like 5.09e-34
Family Pleckstrin-homology domain (PH domain) 0.00000213
Further Details:      
 
Domain Number 5 Region: 1329-1446
Classification Level Classification E-value
Superfamily PH domain-like 2.17e-31
Family Pleckstrin-homology domain (PH domain) 0.00062
Further Details:      
 
Domain Number 6 Region: 1767-1879
Classification Level Classification E-value
Superfamily Fibronectin type III 1.84e-25
Family Fibronectin type III 0.00077
Further Details:      
 
Domain Number 7 Region: 1686-1790
Classification Level Classification E-value
Superfamily Immunoglobulin 9.96e-25
Family I set domains 0.0066
Further Details:      
 
Domain Number 8 Region: 312-449
Classification Level Classification E-value
Superfamily Spectrin repeat 9.03e-18
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 9 Region: 74-215
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-17
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 10 Region: 1536-1599
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000119
Family SH3-domain 0.0000352
Further Details:      
 
Domain Number 11 Region: 859-924
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000603
Family SH3-domain 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000018181
Domain Number - Region: 5-99
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00288
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018181   Gene: ENSCAFG00000012281   Transcript: ENSCAFT00000019600
Sequence length 2201
Comment pep:known_by_projection chromosome:CanFam3.1:33:27457798:27746497:1 gene:ENSCAFG00000012281 transcript:ENSCAFT00000019600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQVTAELDAWNEDLLRQMNDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQY
IMEVQASAGIELICEKDIDLAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQA
EVKQVLGWIRNGESMLNASLVNASSLSEAEQLQREHEQFQLAIEKTHQSALQVQQKAEAL
LQAGHYDADAIRECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEY
RRDEDWCGGRDKLGPAAEIDHVIPLISKHLEQKEAFLKACTLARRNAEVFLKYIHRNNVS
MPSAASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQALDWI
QETGEYYLSTHTSTGETTEETQELLKEYGEFRVPAKQTKEKVKLLIQLADSFVEKGHIHA
TEIRKWVTTVDKHYRDFSLRMGKYRYSLEKALGVNTEDNKDLELDIIPASLSDREVKLRD
ANHEVNEEKRKSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPPGILNKE
HIIFGNIQEIYDFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSNQLI
LEHAGTFFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGELKDGLEVM
LSVPKKANDAMHVSMLEGFDENLDVQGELILQDAFQVWDPKSLIRKGRERHLFLFEISLV
FSKEIKDSSGHTKYVYKNKLLTSELGVTEHVEGDPCKFALWSGRTPSSDNKTVLKASNIE
TKQEWIKNIREVIQERIIHLKGALKEPIQLPKTPAKQRNNSKRDGVEDVDSQGDGSSQPD
TISIASRTSQNTVDSDKLSGGCELTVVLQDFSAGHSSELTIQVGQTVELLERPSERPGWC
LVRTTERSPPQEGLVPSSALCISHSRSSVEMDCFFPLVKDAYSHSSSENGGKSESVANLQ
SQPSLNSIHSSPGPKRSTNTLKKWLTSPVRRLNSGKADGNIKKQKKVRDGRKSFDLGSPK
PGDETTPQGDSADEKNKKGWGEDEPDEESHTPLPPPMKIFDNDPTQDEMSSSLLAARQAS
TEVPSAADLVSAIEQLVKSKLTLEGGSYRGSLKDPVGCLNEGMTPPTPPRNLEEEQKAKA
LRGRMFVLNELVQTEKDYVKDLGIVVEGFMKRIEEKGVPEDMRGKDKIVFGNIHQIYDWH
KDFFLAELEKCIQEQDRLAQLFIKHERKLHVYVWYCQNKPRSEYIVAEYDAYFDEVKQEI
NQRLTLSDFLIKPIQRITKYQLLLKDFLRYSEKAGLECSDIEKAVELMCLVPKRCNDMMN
LGRLQGFEGTLTAQGKLLQQDTFYVIELDAGMQSRTKERRVFLFEQIVIFSELLRKGSLT
PGYMFKRSIKMNYLVLEENVDNDPCKFALMNRETSERVILQAANADIQQAWVQDINQVLE
TQRDFLNALQSPIEYQRKERSTAVMRSQPSRVPQASPRPYSSGPAGSEKPPKGSSYNPPL
PPLKISTSNGSPGFDYHQPGDKFEASKQGDLGGCNGTSSMAVIKDYYALKENEICVSQGE
VVQVLAVNQQNMCLVYQPASDRSPAAEGWVPGSVLAPLTKATAAAENSDGSIKKSCSWHT
LRMRKRAEVENTGKNEATGARKPKDILGNKVSVKETNSSEESECDDLDPNTSMEILNPNF
IQEVAPEFLVPLVDVTCLLGDTVTLQCKVCGRPKPTITWKGPDQNILDTDNSSATYTVSS
CDSGEITLKICNLMPQDSGIYTCIATNDHGTTSTSATVKVQGVPAAPNRPIAQERSCTSV
ILRWLPPSSTGNCTISGYTVEYREEGSQAWQQSVASTLDTYLVIEDLSPGSPYQFRVSAS
NPWGISLPSEPSEFVRLPEYDAAADGATISWKENFDSAYTELNEIGRGRFSIVKKCIHKA
TRKDVAVKFVSKKMKKKEQAAHEAALLQHLQHPQYITLHDTYESPTSYILILELMDDGRL
LDYLMNHDELMEEKVAFYIRDIMEALQYLHNCRVAHLDIKPENLLIDLRIPVPRVKLIDL
EDAVQISGHFHIHHLLGNPEFAAPEVIQGIPVSLGTDIWSIGVLTYVMLSGVSPFLDESK
EETCINVCRVDFSFPHEYFCGVSNAARDFINVILQEDFRRRPTAATCLQHPWLQPHNGSY
SKIPLDTSRLACFIERRKHQNDVRPIPNVKSYIVNRVNQGT
Download sequence
Identical sequences F1PUI1
ENSCAFP00000018181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]