SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018187 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCAFP00000018187
Domain Number - Region: 102-159
Classification Level Classification E-value
Superfamily STAT 0.0471
Family STAT 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018187   Gene: ENSCAFG00000012352   Transcript: ENSCAFT00000019606
Sequence length 280
Comment pep:known_by_projection chromosome:CanFam3.1:7:10895698:10930765:-1 gene:ENSCAFG00000012352 transcript:ENSCAFT00000019606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAPVSGVPSRPRGVEREARPDDGASVAASSREDCRVRCTSKRAVTEMVELCGRFVDKL
GDALPEEIRGPALRDVQWTFESAVQENVSINGQAWQEASDSLIDSDIKVLEDQFDEIIVD
IATKRKQYPRKILECVIKTIKAKQEILKQYCPVVHPLDLKYDPDPASRVETLKYRGETIA
KEISEAMKSLPALIEQGDGFSQVLKMQPIIQLQRVHQEVFSGCYKKPDTKPESFITQIET
TPTETSTRKATDVVLKRRQTEDCPQRKRYPLRPKRINLDT
Download sequence
Identical sequences E2RTF4
XP_005622412.1.84170 ENSCAFP00000018187 ENSCAFP00000018187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]