SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018209 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018209
Domain Number 1 Region: 2632-2922
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-71
Family Protein kinases, catalytic subunit 0.00000108
Further Details:      
 
Domain Number 2 Region: 1271-1450
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.06e-52
Family DBL homology domain (DH-domain) 0.0000000134
Further Details:      
 
Domain Number 3 Region: 1880-2073
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-50
Family DBL homology domain (DH-domain) 0.0000137
Further Details:      
 
Domain Number 4 Region: 1457-1577
Classification Level Classification E-value
Superfamily PH domain-like 7.24e-34
Family Pleckstrin-homology domain (PH domain) 0.00000213
Further Details:      
 
Domain Number 5 Region: 2074-2191
Classification Level Classification E-value
Superfamily PH domain-like 2.93e-31
Family Pleckstrin-homology domain (PH domain) 0.00062
Further Details:      
 
Domain Number 6 Region: 2511-2623
Classification Level Classification E-value
Superfamily Fibronectin type III 2.61e-25
Family Fibronectin type III 0.00077
Further Details:      
 
Domain Number 7 Region: 2430-2534
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-24
Family I set domains 0.0066
Further Details:      
 
Domain Number 8 Region: 278-414
Classification Level Classification E-value
Superfamily Spectrin repeat 7.07e-19
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 9 Region: 1089-1226
Classification Level Classification E-value
Superfamily Spectrin repeat 1.28e-17
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 10 Region: 842-992
Classification Level Classification E-value
Superfamily Spectrin repeat 1.52e-17
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 11 Region: 500-641
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-17
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 12 Region: 2280-2343
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000158
Family SH3-domain 0.0000352
Further Details:      
 
Domain Number 13 Region: 1636-1701
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000833
Family SH3-domain 0.0035
Further Details:      
 
Domain Number 14 Region: 35-182
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000183
Family CRAL/TRIO domain 0.015
Further Details:      
 
Domain Number 15 Region: 191-309
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000183
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 16 Region: 646-766
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000864
Family Spectrin repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018209   Gene: ENSCAFG00000012281   Transcript: ENSCAFT00000019632
Sequence length 2945
Comment pep:known_by_projection chromosome:CanFam3.1:33:27160978:27746497:1 gene:ENSCAFG00000012281 transcript:ENSCAFT00000019632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDRFWDQWYLWYLRLLRLLDRGSFRNDGLKASDVLPILKEKVAFVSGGRDKRGGPILTF
PARSNHDRIRQEDLRKLVTYLASVPSEDVCKRGFTVIIDMRGSKWDLIKPLLKTLQEAFP
AEIHVALIIKPDNFWQKQKTNFGSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNH
EAWIELRLSLEEFFNSAVHLLSRLEDLQEMLARKEFPVDVEGSRRLIDEHTQLKKKVLKA
PVEELDREGQRLLQCIRCSDGFSGRNCIPGSADFQSLVPKITSLLDKLHSTRQHLHQMWH
VRKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQHALDLQTQHNHFAMN
SMNAYVNINRIMSVASRLSEAGHYASQQIKQISTQLDQEWKSFAAALDERSTILAMSAVF
HQKAEQFLSGVDAWCKMCSEGGLPSEMQDLELAIHHHQSLYEQVTQAYTEVSQDGKALLD
VLQRPLSPGNSESLTATANYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCV
FQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEA
AEQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDL
QKEMLEDVCADSVDAVQELIKQFQQQQTATLDATLNVIKEGEDLIQQLRSAPPSLGEPSE
ARDSAVSNNKTPHSSSISHIESVLQQLDDAQVQMEELFHERKIKLDIFLQLRIFEQYTIE
VTAELDAWNEDLLRQMNDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIM
EVQASGIELICEKDIDLAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVK
QVLGWIRNGESMLNASLVNASSLSEAEQLQREHEQFQLAIEKTHQSALQVQQKAEALLQA
GHYDADAIRECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRD
EDWCGGRDKLGPAAEIDHVIPLISKHLEQKEAFLKACTLARRNAEVFLKYIHRNNVSMPS
AASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQALDWIQET
GEYYLSTHTSTGETTEETQELLKEYGEFRVPAKQTKEKVKLLIQLADSFVEKGHIHATEI
RKWVTTVDKHYRDFSLRMGKYRYSLEKALGVNTEDNKDLELDIIPASLSDREVKLRDANH
EVNEEKRKSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPPGILNKEHII
FGNIQEIYDFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSNQLILEH
AGTFFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGELKDGLEVMLSV
PKKANDAMHVSMLEGFDENLDVQGELILQDAFQVWDPKSLIRKGRERHLFLFEISLVFSK
EIKDSSGHTKYVYKNKLLTSELGVTEHVEGDPCKFALWSGRTPSSDNKTVLKASNIETKQ
EWIKNIREVIQERIIHLKGALKEPIQLPKTPAKQRNNSKRDGVEDVDSQGDGSSQPDTIS
IASRTSQNTVDSDKLSGGCELTVVLQDFSAGHSSELTIQVGQTVELLERPSERPGWCLVR
TTERSPPQEGLVPSSALCISHSRSSVEMDCFFPLVKDAYSHSSSENGGKSESVANLQSQP
SLNSIHSSPGPKRSTNTLKKWLTSPVRRLNSGKADGNIKKQKKVRDGRKSFDLGSPKPGD
ETTPQGDSADEKNKKGWGEDEPDEESHTPLPPPMKIFDNDPTQDEMTLEGGSYRGSLKDP
VGCLNEGMTPPTPPRNLEEEQKAKALRGRMFVLNELVQTEKDYVKDLGIVVEGFMKRIEE
KGVPEDMRGKDKIVFGNIHQIYDWHKDFFLAELEKCIQEQDRLAQLFIKHERKLHVYVWY
CQNKPRSEYIVAEYDAYFDEVKQEINQRLTLSDFLIKPIQRITKYQLLLKDFLRYSEKAG
LECSDIEKAVELMCLVPKRCNDMMNLGRLQGFEGTLTAQGKLLQQDTFYVIELDAGMQSR
TKERRVFLFEQIVIFSELLRKGSLTPGYMFKRSIKMNYLVLEENVDNDPCKFALMNRETS
ERVILQAANADIQQAWVQDINQVLETQRDFLNALQSPIEYQRKERSTAVMRSQPSRVPQA
SPRPYSSGPAGSEKPPKGSSYNPPLPPLKISTSNGSPGFDYHQPGDKFEASKGDLGGCNG
TSSMAVIKDYYALKENEICVSQGEVVQVLAVNQQNMCLVYQPASDRSPAAEGWVPGSVLA
PLTKATAAAENSDGSIKKSCSWHTLRMRKRAEVENTGKNEATGARKPKDILGNKVSVKET
NSSEESECDDLDPNTSMEILNPNFIQEVAPEFLVPLVDVTCLLGDTVTLQCKVCGRPKPT
ITWKGPDQNILDTDNSSATYTVSSCDSGEITLKICNLMPQDSGIYTCIATNDHGTTSTSA
TVKVQGVPAAPNRPIAQERSCTSVILRWLPPSSTGNCTISGYTVEYREEGSQAWQQSVAS
TLDTYLVIEDLSPGSPYQFRVSASNPWGISLPSEPSEFVRLPEYDAAADGATISWKENFD
SAYTELNEIGRGRFSIVKKCIHKATRKDVAVKFVSKKMKKKEQAAHEAALLQHLQHPQYI
TLHDTYESPTSYILILELMDDGRLLDYLMNHDELMEEKVAFYIRDIMEALQYLHNCRVAH
LDIKPENLLIDLRIPVPRVKLIDLEDAVQISGHFHIHHLLGNPEFAAPEVIQGIPVSLGT
DIWSIGVLTYVMLSGVSPFLDESKEETCINVCRVDFSFPHEYFCGVSNAARDFINVILQE
DFRRRPTAATCLQHPWLQPHNGSYSKIPLDTSRLACFIERRKHQNDVRPIPNVKSYIVNR
VNQGT
Download sequence
Identical sequences F1PPJ4
ENSCAFP00000018181 ENSCAFP00000018209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]