SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018218 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018218
Domain Number 1 Region: 1377-1428,1474-1654
Classification Level Classification E-value
Superfamily VPS9 domain 1.2e-41
Family VPS9 domain 0.0021
Further Details:      
 
Domain Number 2 Region: 12-218
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.15e-36
Family Regulator of chromosome condensation RCC1 0.0047
Further Details:      
 
Domain Number 3 Region: 519-686
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 6.54e-27
Family beta-lactamase inhibitor protein-II, BLIP-II 0.066
Further Details:      
 
Domain Number 4 Region: 1046-1135
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 1.29e-23
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0099
Further Details:      
 
Domain Number 5 Region: 1140-1248
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 2.35e-18
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.024
Further Details:      
 
Domain Number 6 Region: 926-1012
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000137
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 7 Region: 691-890
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000000000563
Family DBL homology domain (DH-domain) 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018218   Gene: ENSCAFG00000012360   Transcript: ENSCAFT00000019642
Sequence length 1656
Comment pep:known_by_projection chromosome:CanFam3.1:37:10755260:10812292:-1 gene:ENSCAFG00000012360 transcript:ENSCAFT00000019642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSKKRSSTEAEGSKERGLVHVWQAGSYSVTPERLPGWGGKTVLQAALGVKHGVLLTEDG
EVYSFGTLPWRSEPAEICPSCPILENALIGQFVVTVASGSFHNGAVTESGVAYMWGENSA
GQCAVANQQYVPEPNPVSISDSETSSLLAVRILQLACGEEHTLALSISREIWAWGTGCQL
GLITTTFPVTKPQKVEHLAGRVVLQVACGAFHSLALVQCLPSQDLKPVPERCNQCSQLLI
TMTDKEDHVIISDSHCCPLGVTLSESQAENQASTAISPSTETLDNQEVFENTLVENELPV
ATDTNVGNVQTTGGDAISSQQEIMGTTEIPSAQNIPSYPDTQAVNEYMQKLSDHSVRDNS
ENGKKPMPSQPLVEEAVPNLHSPPTTSTSALNSLVVSCASAVGVRVAATYEAGALSLKKV
MNFYSTAPCEPGTQAGSSSIGPEGLKDSREEQVKQESMQGKKSSSLVDIREEESEGGSRR
LSLPGLLSQVSPRLLRKAARVKTRTVVLTPTYSGEADALLPSLRTEVWTWGKGKEGQLGH
GDVLPRLQPLCVKCLDGKEVIYLEAGGYHSLALTAKSQVYSWGSNTFGQLGHYDFPTTVP
RLAKVSSENGVWSVAAGQDYSLFLVDTEDFQPGLYYSGRQDPAEGDNLPENHSGTKTPVL
LSCSKLGYISRVTAGKDSYLALVDKNVMGYIASLHELATTERRFYAKLSDIKSQILRPLL
SLENLGTASTVQLLQEVASRFSKLCYLIGQHGASLSSFLHGIKEARSLVILKHASLFLDS
YTEYCTSITNFLVMGGFQLLAKPAIDFLNKNQELLQDLSEVNDENTQLMEILNTLFFLPI
RRLHNYAKVLLKLATCFEVTSPEYQKLQDSSSCYECLALHLGRKRKEAEYTLGFWKTFPG
KMTDSLRKPERRLLCESSNRALSLQHAGRFSVNWFILFNDALVHAQFSTHHVFPLATLWA
EPLSEEAGGVNGLKITTPEEQFTLISSTPQEKTKWLRAISQAVDQALRGTADLPPYGSGS
SIQRQEPPISRSAKYTFYKDPRLKDATYDGRWLSGKPHGRGVLKWPDGKMYSGMFRNGLE
DGYGEYRIPNKALNKEDHYVGHWKEGKMCGQGVYSYASGEVFEGCFQDNMRHGHGLLRSG
KLTSSSPSMFIGQWVMDKKAGYGVFDDITRGEKYMGMWQDDVCQGNGVVVTQFGLYYEGN
FHLNKMMGNGVLLSEDDTIYEGEFSDDWTLSGKGTLTMPNGDYIEGYFSGEWGSGIKITG
TYFKPSLYESDKDRPKVFRKLGNLAVSADEKWKAVFDECWHQLGCENPGQGEVWKAWDNI
AVALTTNRRQHRDSPETLSRSQTQTLESLEFIPQHVGAFSVEKYDDIKKYLIKACDTPLH
PLGRLVETLVAVYRMTYVGVGANRRLLQEAVKEIKSYLKRIFQLVRFLFPELPEEGSTIP
LSAPLPTERKSFCTGKSDSRSESPEPGYVVTSSGLLLPVLLPRLYPPLFMLYALDNDREE
DIYWECVLRLNKQPDIALLGFLGVQRKFWPVTLSILGESKKVLPTTKDACFASAVECLQQ
ISTTFTPSDKLKVIQQTFEEISQSVLASLQEDFLWSMDDLFPVFLYVVLRARIRNLGSEV
HLIEDLMDPYLQHGEQGIMFTTLKACYYQIQREKLN
Download sequence
Identical sequences E2RSG1
XP_003640234.1.84170 XP_005640602.1.84170 ENSCAFP00000018218 ENSCAFP00000018218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]