SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018384 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018384
Domain Number 1 Region: 65-168
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000079
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000018384
Domain Number - Region: 311-367
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000294
Family BCR-homology GTPase activation domain (BH-domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018384   Gene: ENSCAFG00000012482   Transcript: ENSCAFT00000019818
Sequence length 378
Comment pep:novel chromosome:CanFam3.1:32:38677179:38716253:-1 gene:ENSCAFG00000012482 transcript:ENSCAFT00000019818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRLDLSGSEIEPQKGLNHMSPGFFSQCHQLERGVKPPWEFIQRKSSSVEVDTDSESTTS
SEGATRTLLIHGPVELKRGWRRQKQQLFLYSDLLLMSNTKYKKNFKIKKKIPLNTMWIAN
CMDTVGDASNHSGRSFVLGWPMVNFVATFSSSEQKEKWRSYLQRYIMLAKEKEQPKSIHL
KIFTDDKNSACGSEKDYQLWASSGKEEVPLIGHEHPYGIKMSHIPSTKPLSKEPEDSISP
STTQESLLLEQKIIEMQIQFMLKPRHPAQNKQGRGQKTTKSSAFRNLAFWRHAGTCQNNL
CSAAPSAKPRQLFGVSLTHICDNDNLPVPILDFLRNTQGGIFSFDLYDKWLGVINEGTKE
EKINAAQSDRKTTCESKH
Download sequence
Identical sequences F1PIJ5
XP_005639382.1.84170 ENSCAFP00000018384 ENSCAFP00000018384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]