SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018496 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018496
Domain Number 1 Region: 1381-1479
Classification Level Classification E-value
Superfamily PH domain-like 1.92e-25
Family Pleckstrin-homology domain (PH domain) 0.002
Further Details:      
 
Domain Number 2 Region: 38-135
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.33e-20
Family FHA domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000018496
Domain Number - Region: 762-862,1382-1402
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0262
Family BAR domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018496   Gene: ENSCAFG00000012537   Transcript: ENSCAFT00000019942
Sequence length 1490
Comment pep:known_by_projection chromosome:CanFam3.1:5:15092050:15138495:-1 gene:ENSCAFG00000012537 transcript:ENSCAFT00000019942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDALNRNQVGPGCKTQAMVKKGPLDLIETGKGLKVQTDKPHLVSLGSGRLSTAITLLPLE
EGKTVIGSAARDISLQGPGLAPEHCYIENVRGTLTLYPCGNACSIDGLPIRQPTRLTQGC
MVCLGQSTFLRFNHPAEAKWMKSMIPAGGRAPGPPYSPGSESESLVNGNHTPQPATRGPS
ACASHSSLVSSIEKDLQEIMDSLVLEEPGAAGKKPAATSPLSPMANGGRYLLSPPTSPGA
MSVGSSYENTSPAFSPLSSPASSGSCASHSPSGQEPAPSMPPLVPARSSSYHLALQPPQP
RPSGARPSESPRLGRKGGHERPPSPGLRGLLTDSPAATVLAEARRATESPRLGGQLPVVA
ISLSEYPASGARSQPTSIPGSPKFQPPVPAPRNKIGTLQDRPPSPFRELPSTERVLTTSP
SRQLVGRTFSDGSVARTLQPPESPRLGRRGLDSMRELPPLSPSLSRRALSPMPTRTTPDP
KLTREVAESPRPRRWAAHGASPEDFSLTLGARGRRTRSPSPTLGESLAPRKGSFSGRLSP
AYSLGSLTGASPRQSPRAQRKLSSGDLRVPVTRERKNSITEISDNEDDLLEYHRRQRQER
LWEQEMERLERQRLETILNLCAEYSRADGGLEAGELPSIGEAAAALALAGRRPSRGLSGA
PGASGRSTEEPGGATPRLWECVERSDEENLKEECSSTESTQQEHEDAPSTKLQGEVLALE
EERAQVLGRVEQLKVRVKELEQQLQESAREAEMERALLQGEREAERALLQKEQKAVDQLQ
EKLVTLETGIQKERDKEAEALETETKLFEDLEFQQLERESRVEEERELAGQGLLRSQAEL
LRSITKRKERLAVLDSQAGQIRAQAVQESERLARDKNASLQLLQKEKERLTMLEGRYHSL
TGGRPFPKTTSTLKEAELLISESSEMGLGSATLVPFPGSSQPGAFSVPLTQPASTQLCPK
AQEYVTLEQLKVMWGTSPVPTAPAPGLPFWASASRDLVPTTCLPPVLPSSSSSASLTPSP
KMEELLLPAVDLEQWYQELMAGLGTGPAAASPRSSPPPLPAKASRQLQVYRSKMDGEATS
PLPRTRSGPLPSSSGSSSSSSQLSVATLGRSPSPKSALLAQNGTGSLPRNLAATLQDIET
KRQLALQQKGESLPAEPPPADDPAGQQVIEEQRRRLAELKQKAAAEAQCQWDALHGAAPF
PPGPSGFPPLMHHSILHHLPAGRERGEEGEHAYDTLSLESSDSMETSISTGGNSACSPDN
MSSASGLDVGKIEEMEKMLKEAHAEKSRLMESREREMELRRQALEEERRRREQVERRLQS
ESARRQQLVEKEVKMREKQFSQARPLTRYLPIRKEDFDLKTHIESSGHGVDTCLHVVLSS
KVCRGYLVKMGGKIKSWKKRWFVFDRLKRTLSYYVDKHETKLKGVIYFQAIEEVYYDHLR
SAAKSPNPALTFCVKTHDRLYYMVAPSAEAMRIWMDVIVTGAEGYTQFMN
Download sequence
Identical sequences E2RMC8
ENSCAFP00000018496 ENSCAFP00000018496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]