SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018503 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018503
Domain Number 1 Region: 507-772
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.72e-81
Family Protein kinases, catalytic subunit 0.0000224
Further Details:      
 
Domain Number 2 Region: 344-462
Classification Level Classification E-value
Superfamily PH domain-like 6.78e-33
Family Pleckstrin-homology domain (PH domain) 0.0000114
Further Details:      
 
Domain Number 3 Region: 46-118
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.21e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00071
Further Details:      
 
Domain Number 4 Region: 184-242
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.24e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018503   Gene: ENSCAFG00000012553   Transcript: ENSCAFT00000019949
Sequence length 833
Comment pep:known_by_projection chromosome:CanFam3.1:8:9004514:9327083:-1 gene:ENSCAFG00000012553 transcript:ENSCAFT00000019949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACSIVDQKFPECGFYGMYDKILLFRHDPTSENILQLVKTASDIQEGDLIEVVLSASATF
EDFQIRPHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGV
RRRRLSNVSLTGLSTVRTASAELSSSAPDEPLLQKSPSESFIGREKRSNSQSYIGRPIQL
DKILMSKVKVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQCKDCRFNCHKRCASKVPNN
CLGEVTINGDLLSPGAESDVVMEEGSDDNDSERNSGLMDDMEEAMVQDAEVVMAECQNDS
GEMQDPDPDPEDSNRTISPSTSNNIPLMRVVQSVKHTKRKSSTVLKEGWMVHYTSKDTLR
KRHYWRLDSKCITLFQNDTGSRYYKEIPLSEILSLEPAKPSALIPNGANPHCFEITTANV
VYYVGENVVNPSSPPPNSSVLTSGVGADVARMWEMAIQHALMPVIPKGSTVGSGTNSHRD
ISVSISVSNCQVQENVDISTVYQIFPDEVLGSGQFGIVYGGKHRKTGRDVAIKIIDKLRF
PTKQESQLRNEVAILQNLHHPGVVNLECMFETPERVFVVMEKLHGDMLEMILSSEKGRLP
EHITKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSF
RRSVVGTPAYLAPEVLRNKGYNRSLDMWSVGVIIYVSLSGTFPFNEDEDIHDQIQNAAFM
YPPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTLSHPWLQDYQTWLDLRELECKIGERY
ITHESDDLRWEQYAGEQGLRYPAHLITPSASHSEGPETEETEMKALSERVSIL
Download sequence
Identical sequences F1PSL4
ENSCAFP00000018503 ENSCAFP00000018503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]