SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018669 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018669
Domain Number 1 Region: 375-511
Classification Level Classification E-value
Superfamily Cyclin-like 4.97e-20
Family Cyclin 0.014
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000018669
Domain Number - Region: 108-113
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000942
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 89-159
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00915
Family beta-sandwich domain of Sec23/24 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018669   Gene: ENSCAFG00000012693   Transcript: ENSCAFT00000020129
Sequence length 529
Comment pep:known_by_projection chromosome:CanFam3.1:24:46361599:46375886:-1 gene:ENSCAFG00000012693 transcript:ENSCAFT00000020129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAGGAAAAGGRRAQSEDGRGRGGWSPGPDPRPRQGPAARRPRPRRPGPAAVVRRRGDSR
RRQAVLFFLNNISLDGRPPSLGPGGEKPPPPPPPPPPPAEAREPPGPPPPPPPGPPGPPG
PEPPARGDPPTPPPPPATPGGLPATRAAAPQGLLSPAPGPGLGLPLDGQRQRRRVASQRC
SLEFLEDAVGCASVQRTKHISGSPRHKGLKKTHFIKNMRQYDTRNSRIVLICAKRSLCAA
FSVLPYGEGLRVSDLRVDSQKQRHPSGGVSVSSEMVFELEGVELGADGKVVSYAKFLYPT
NALVTHKTDSHGLPPQPRPSVPRTLPASRYKAAPAKSAPTGAELGTDVGDALEYNPNLLD
DPQWPCGKHKRVLIFASYMTTVIEYVKPSDLKKDMNETFREKFPHIKLTLSKIRSLKREM
RNLSEECSLEPVTVSMAYVYFEKLVLQGKLNKQNRKLCAGACVLLAAKISSDLRRSEVKQ
LIDKLEERFRFNRRDLIGFEFTVLVALELALYLPESQVLPHYRRLTQQC
Download sequence
Identical sequences F1PP60
ENSCAFP00000018669 ENSCAFP00000018669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]