SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018702 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018702
Domain Number 1 Region: 5-364
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.84e-134
Family Motor proteins 0.00000000000334
Further Details:      
 
Domain Number 2 Region: 531-636
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.55e-28
Family FHA domain 0.00000751
Further Details:      
 
Domain Number 3 Region: 1694-1791
Classification Level Classification E-value
Superfamily PH domain-like 1.45e-23
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018702   Gene: ENSCAFG00000012713   Transcript: ENSCAFT00000020163
Sequence length 1812
Comment pep:known_by_projection chromosome:CanFam3.1:25:50859013:50923122:-1 gene:ENSCAFG00000012713 transcript:ENSCAFT00000020163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHT
SPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIP
QLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVED
LSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEK
VSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKK
TDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVI
NEDPNNKLIRELKDEVTRLRDLLYAQGLGDITDSECLCPPVPGPGQADVSDLENNNRNRG
GAELSPAPDNLSTVTNALVGMSPSSSLSALSSRAASVSSLHERILFAPGSEEAIERLKET
EKIIAELNETWEEKLRRTEAIRMEREALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNED
PLMSECLLYYIKDGITRVGREDAERRQDIVLSGHFIKEEHCVFRSDSRGGSEAVVTLEPC
EGADTYVNGKKVTEPSILRSGNRIIMGKSHVFRFNHPEQARQERERTPCAETPAEPVDWA
FAQRELLEKQGIDMKQEMEQRLQELEDQYRREREEATYLLEQQRLDYESKLEALQKQMDS
RYYPEVNEEEEEPEDEVQWTERECELALWAFRKWKWYQFTSLRDLLWGNAIFLKEANAIS
VELKKKVQFQFVLLTDTLYSPLPPDLLPPEAAKDRETRPFPRTIVAVEVQDQKNGATHYW
TLEKLRQRLDLMREMYDRAAEVPSSVIEDCDNVVTGGDPFYDRFPWFRLVGSNSYPLLNT
CMSERMAALTPSPTFSSPDSDATEPAEEQSVGEEEEEEEEEEEEEDLEDDVFPEHALCDG
RDPFYDRPPLFSLVGRAFVYLSNLLYPVPLVHRVAVVSEKGEVKGFLRVAVQATSADEEA
PDYGSGVRQSGTARISFDDQHFEKSESCPVVGMSRSGTSQEELRIVEGQGQGADTGPSAD
EVNNNTCSAVPPEGLLLDSPEKAATDGPLDAALDHLRLGSTFTFRVTVLQASSISAEYAD
IFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNIAVEVTKSFIEYIKSQPIVFEVFG
HYQQHPFPPLCKDVLSPLRPSRRHFPRVMPLSKPVPATKLSTLARPCPGPCHCKYDLLVY
FEICELEANGDYIPAVVDHRGGMPCMGTFLLHQGIQRRITVTLLHETGSHIRWKEVRELV
VGRIRNTPETDESLIDPNILSLNILSSDYIHPAQDDRTFYQFEAAWDSSMHNSLLLNRVT
PYREKIYMTLSAYIEMENCTQPAVITKDFCMVFYSRDAKLPASRSIRNLFGSGSLRASES
NRVTGVYELSLCHVADAGSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWE
LEKLSLLQEVEKTRHYLLLREKLETTQRPGPEAPSPASSEDLGSHGSSSPSSPLSAEGRP
SPLETPNERQRELAVKCLRLLTHTFNREYTHSHVCISASESKLSEMSVTLLRDPSMSPLG
AATLTPSSTCPSLVEGRYGAAELRTPQPCSRPASPEPEPVPEADSKKLPSPARAAEADKE
PQRLLVPDIQEIRVSPIVSKKGYLHFLEPHTAGWAKRFVVVRRPYAYLYNSDKDSVERFV
LNLSTAQVEYSEDQQAMLKTPNTFAVCTEHRGILLQANSDKDMHDWLYAFNPLLAGTIRS
KLSRRRSAQMRV
Download sequence
Identical sequences E2RN64
ENSCAFP00000018702 ENSCAFP00000018702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]