SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018743 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018743
Domain Number 1 Region: 60-186
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-51
Family Phosphotyrosine-binding domain (PTB) 0.0000688
Further Details:      
 
Domain Number 2 Region: 529-604
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000021
Family SH3-domain 0.00005
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000018743
Domain Number - Region: 724-770
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000115
Family Pointed domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018743   Gene: ENSCAFG00000012724   Transcript: ENSCAFT00000020206
Sequence length 820
Comment pep:known_by_projection chromosome:CanFam3.1:27:31003342:31069238:1 gene:ENSCAFG00000012724 transcript:ENSCAFT00000020206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGHISNHPSGFGMYPSQMNGYGSSPFSQMDREHSSKTSAKALYEQRKNYARDSVSSVSD
ISQYRVEHLTTFVLDRKDAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLES
KNELENFPLSTIQHCQAVMHSCNYDSVLALVCKEPTQNKPDLHLFQCDEIKANLISEDIE
SAISDSKGGKQKRRPEALRMISKADPGIPPPPRAPAPVPPGTVTQVDVRSRVAAWSAWAA
DQGDFEKPRQYHEQEETPEMMAARIDRDVQILNHILDDIEFFITKLQKAAEAFSELSKRK
KSKKGKKKGPGEGVLTLRAKPPPPDEFVDCLQKFKHGFNLLAKLKSHIQNPSATDLVHFL
FTPLNMVVQATGGPELASSVLSPLLTKDTIDFLNYTVNNDERQLWMSLGETWMKARAEWP
KEQFIAPYVPRFRNGWEPPMLNFMGAPMEQDFYQLAESVANVAEHQRKQETKRLSTEQSS
VSEYPPADGYAFNNMYTRGPQLDQGEAAVAFKPTPNRHMDRNYDPLKGQPKKYAKSKYDF
VARNNSELSVLKDDILEILDDRKQWWKVRNASGDSGFVPNNILDIVRPPESGLGRADPPY
THTIQKQRMEYGPRPTDTPSAPSPPPTPAPVPVPLPPSTPAPVSVPKVPANVTRQNSSSS
DSGGSIVRDNQRHKQLPVDRRKSQMEEVQDELIHRLTIGRSAAQKKFHVPRQNVPVVNIT
YDSTPEDVKTWLQSKGFSPVTVNSLGVLNGAQLFSLNKDELKTVCPEGSRVFSQITVQKA
ALEDNSGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH
Download sequence
Identical sequences F1PLS1
ENSCAFP00000039485 ENSCAFP00000018743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]