SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018744 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018744
Domain Number 1 Region: 1595-1895
Classification Level Classification E-value
Superfamily BEACH domain 6.8e-126
Family BEACH domain 0.00000000853
Further Details:      
 
Domain Number 2 Region: 2017-2279
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.83e-29
Family WD40-repeat 0.0029
Further Details:      
 
Domain Number 3 Region: 1492-1594
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-26
Family PreBEACH PH-like domain 0.0064
Further Details:      
 
Domain Number 4 Region: 175-325
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000576
Family Laminin G-like module 0.053
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000018744
Domain Number - Region: 14-143,467-490,531-725,754-770
Classification Level Classification E-value
Superfamily ARM repeat 0.000211
Family HspBP1 domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018744   Gene: ENSCAFG00000012644   Transcript: ENSCAFT00000020205
Sequence length 2307
Comment pep:known_by_projection chromosome:CanFam3.1:37:11962805:12065413:1 gene:ENSCAFG00000012644 transcript:ENSCAFT00000020205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVFKERIGYTHMFEVLKSLGQPPLELLKELMNMAVEGDHTSVGILGISNVHPLLLLIQWL
PELESHDLQIFISDWLKRICCINRQSRTTCVNANMGIHIIKTLDSHSSLHRTCAENLIAL
HGSLGSQSVSSEEIRRLLRLLRVDESEYIHPYTTPVTRAILTMARKQSLESALQYFNLSH
SMAGITVPSIQKWPGSAFSFNAWFCLDQDQLTLGIANKGGKRKQLYSFFTGSGMGFEAFI
THSGMLVVAVCTKREYATVMLPDHSFCDSLWHNITIVHMPGKRPFGQSLVYIYDNGQQKV
SAPLRFPAMNEPFISCCIGSAGQRTTTPPPSQIPDPPFSSPITPHRTSFGGILSSASWGG
SLEKSKLITKLISAGTQDSEWGCPTSLEGQLGSVIIFYEALQPPQVKALYLAGPNCLSPW
KFQESDMADLPGNILLHYTAKACKNSICLDLSTNCLHGRLTGNKVVNWDIKDIINCIGGL
NVLFPLLEQISRFGEGQISEGMNESTVSELVTPVEGDWVVLTSTKASESRLERNLIATFI
LIVKHFIQRHPINQDNLIHSHGVATLGALLQKVPSALMDVNVLMAIQLLIEQVSLEKNMQ
LLQQMYQYLLFDFRIWNRGDFPFRIGHIQYLSTIIKDSRRVFRKKYGVQFLLDTLRIYYG
TDCKYSELSLDDVRTIRTSLYGLIKYFLCKGGTHEEIQSIMGYIAAINEEEQLFGILDML
FSLLRTSPTRGQLFLLLFEPGNADILYALLLNQKYSDRLREIVFKVMEQMLKCTNVYERS
KQRIRLREVGYSGLGLLLNEASVNTSLIKSLTNQIINTDPAINFKDLLSVVYISHRTHIN
VRVVVCKKILQILQSQPDAAHQISQQVGWQDTLVKLFLKMNFENGNTLHKHSRAVSMKDN
DKNISAEDTRRNFDEKTDEEKINSFASANVPSDQWSLEDRHSLDSNTPLFQEDSSVGELS
FKSENQEEFWNNNLSHLSLDLSGIDSCELSDNGSHMPDSLPSTPSPIESTKSFSVQSDKE
SSIISDTGFGDDFSLLESQERCEEELLQLLTNILNYVMCKGLEKSDDDTWIERGQVFSAL
TKPGISSELLRPSDEIKLILLQKMLEWAITENRESKTNPVTADNALRLIVIIQDFLQSEG
LVNSNMWTEKLLEDLMLLFDGLSVCCSESTIWRELPQIQIQLLLGFIGRGNVQVCAMASA
KLNTLLQTKVIENQNEACYILGKLEHVLSQSIKEQTEIYSFLIPLVRTLVSKIYELLFMN
LHLPSLPFTNGSSSFFEDFQEYCSSNEWQVYIEKYIVPYMKQYETHTFYNNHESMALYWK
NCYEALMVNMHKRDREGGESKLKFQEFFVEPFNRKARQENMRYNNTLKQLSSQQLITLRR
WKAVQLYLTSERGPWAERKQNPIHWKLANVENYSRMRLKLVPNHNFKTHEDASALRDNLG
VQHSQPSSDSLLLEVVKQVKVSNMEEDKLDLPEEDVTARVNTDEKEEQDQKEKLVLSEDC
ELITIIDVIPGRLEITTQHIYFYDCSIEKEDGFLLFSGVGFDFKWPHSQVREIHLRRYNL
RRSALEIFHVDQSNYFLNFKKEIRNKVYSRLLSLHSPNSYGTRSPQELFKASGLTQKWVN
REISNFDYLIQINTMAGRTYNDLAQYPVFPWILQDYTSEELDLNNPSVFRDLSKPIGVVN
DKNAKAMREKYENFEDPMGTIDKFHYGTHYSNSAGVMHYLIRTEPFTTLHIQLQSGRFDC
ADRQFHSIPATWQALMDNPYDVKELIPEFFYFPEFLENQNQFNLGCLQVSKEVVNDVILP
KWAKSAEDFIYKHRKALESEYVSAHLHEWIDLIFGYKQRGPAAVEALNVFYYCSYEGAVD
LDALTDEKERKALEGMINNFGQTPCQLLKEPHPPRLSAEEAVQRQTKTDTSTLNLFQHLS
ELKSFFIEGISDGVPLIKAIVPKNQSRSFMSQGSPELLVTVSMNYVLGTHGWLPYDRNIS
NYFTFIKDQTVTNPKTQRSMNGPFAPGLEITSKLFIVSHDAKLLFSAGHWDNSIQVMSLT
KGKVISHNIRHMDIVTCLATDYCGIHLISGSRDTTCMIWQITQQGGVPVGLASKPFHILY
GHTDEVLSVGISTELDMAVSGSRDGTVIIHTIQKGQYMRTLRPPCESSLLLTVPNLAISW
EGHIVIYSCTEEKTSLKDKNALHLFSVNGKYLGSQVLTEQVSDICITGEHIITGSLQGFL
SIRDLHSLNLSMNPLAMRMPIHCVCVTKEYSHILVGLEDGKLIVVGVGKPAEMRSGQLSR
KLWGSSKRLSQISAGETEYNTQDSKYK
Download sequence
Identical sequences E2RM94
ENSCAFP00000018744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]