SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018753 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018753
Domain Number 1 Region: 1983-2283
Classification Level Classification E-value
Superfamily BEACH domain 8.37e-126
Family BEACH domain 0.00000000853
Further Details:      
 
Domain Number 2 Region: 2405-2667
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.96e-29
Family WD40-repeat 0.0029
Further Details:      
 
Domain Number 3 Region: 1886-1982
Classification Level Classification E-value
Superfamily PH domain-like 1.19e-26
Family PreBEACH PH-like domain 0.0045
Further Details:      
 
Domain Number 4 Region: 11-537,861-884,925-1119,1148-1166
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000034
Family Mo25 protein 0.057
Further Details:      
 
Domain Number 5 Region: 569-719
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000062
Family Laminin G-like module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018753   Gene: ENSCAFG00000012644   Transcript: ENSCAFT00000020215
Sequence length 2693
Comment pep:known_by_projection chromosome:CanFam3.1:37:11896242:12065380:1 gene:ENSCAFG00000012644 transcript:ENSCAFT00000020215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRERLFELWMLYCTKKDPDYLKLWLDNFVSSYEQFLDVDFEKLPTRVDDVPPGISLLP
DNILQVLRIQLLQCVQKMADGLEEQQQALSILLVKFFIILCRNLSNVEEIGTCSYINHVI
TMTTLYIQQLKSKKKEKELADQTSIEEFVIHALAFCESLYDPYRNWRHRISGRILSTVEK
SRQKYKPASLTVEFVPFFYQCFQESEHLKESLKCCLLHLFGAIVAGGQRNALQAISPATM
EVLMRVLADCDSWEDGNPEEVGRKVELTLKCLTEVVHILLTSSSDQRQVETSTILENYFK
LLNSDPSALPNQRRSRQWESRFITLQIKMLNTITAMLDCTDRPVLQAIFLNSNCFEHLIR
LLQNCKVFQGQLDCLAISTIQALTAVMNKSPAAKEVFKERIGYTHMFEVLKSLGQPPLEL
LKELMNMAVEGDHTSVGILGISNVHPLLLLIQWLPELESHDLQIFISDWLKRICCINRQS
RTTCVNANMGIHIIKTLDSHSSLHRTCAENLIALHGSLGSQSVSSEEIRRLLRLLRVDES
EYIHPYTTPVTRAILTMARKQSLESALQYFNLSHSMAGITVPSIQKWPGSAFSFNAWFCL
DQDQLTLGIANKGGKRKQLYSFFTGSGMGFEAFITHSGMLVVAVCTKREYATVMLPDHSF
CDSLWHNITIVHMPGKRPFGQSLVYIYDNGQQKVSAPLRFPAMNEPFISCCIGSAGQRTT
TPPPSQIPDPPFSSPITPHRTSFGGILSSASWGGSLEKSKLITKLISAGTQDSEWGCPTS
LEGQLGSVIIFYEALQPPQVKALYLAGPNCLSPWKFQESDMADLPGNILLHYTAKACKNS
ICLDLSTNCLHGRLTGNKVVNWDIKDIINCIGGLNVLFPLLEQISRFGEGQISEGMNEST
VSELVTPVEGDWVVLTSTKASESRLERNLIATFILIVKHFIQRHPINQDNLIHSHGVATL
GALLQKVPSALMDVNVLMAIQLLIEQVSLEKNMQLLQQMYQYLLFDFRIWNRGDFPFRIG
HIQYLSTIIKDSRRVFRKKYGVQFLLDTLRIYYGTDCKYSELSLDDVRTIRTSLYGLIKY
FLCKGGTHEEIQSIMGYIAAINEEEQLFGILDMLFSLLRTSPTRGQLFLLLFEPGNADIL
YALLLNQKYSDRLREIVFKVMEQMLKCTNVYERSKQRIRLREVGYSGLGLLLNEASVNTS
LIKSLTNQIINTDPAINFKDLLSVVYISHRTHINVRVVVCKKILQILQSQPDAAHQISQQ
VGWQDTLVKLFLKMNFENGNTLHKHSRAVSMKDNDKNISAEDTRRNFDEKTDEEKINSFA
SANVPSDQWSLEDRHSLDSNTPLFQEDSSVGELSFKSENQEEFWNNNLSHLSLDLSGIDS
CELSDNGSHMPDSLPSTPSPIESTKSFSVQSDKESSIISDTGFGDDFSLLESQERCEEEL
LQLLTNILNYVMCKGLEKSDDDTWIERGQVFSALTKPGISSELLRPSDEIKLILLQKMLE
WAITENRESKTNPVTADNALRLIVIIQDFLQSEGLVNSNMWTEKLLEDLMLLFDGLSVCC
SESTIWRELPQIQIQLLLGFIGRGNVQVCAMASAKLNTLLQTKVIENQNEACYILGKLEH
VLSQSIKEQTEIYSFLIPLVRTLVSKIYELLFMNLHLPSLPFTNGSSSFFEDFQEYCSSN
EWQVYIEKYIVPYMKQYETHTFYNNHESMALYWKNCYEALMVNMHKRDREGGESKLKFQE
FFVEPFNRKARQENMRYNNTLKQLSSQQLITLRRWKAVQLYLTSERGPWAERKQNPIHWK
LANVENYSRMRLKLVPNHNFKTHEDASALRDNLGVQHSQPSSDSLLLEVVKQVKVSNMEE
DKLDLPEEDVTARVNTDEKEEQDQKEKLVLSEDCELITIIDVIPGRLEITTQHIYFYDCS
IEKEDGVGFDFKWPHSQVREIHLRRYNLRRSALEIFHVDQSNYFLNFKKEIRNKVYSRLL
SLHSPNSYGTRSPQELFKASGLTQKWVNREISNFDYLIQINTMAGRTYNDLAQYPVFPWI
LQDYTSEELDLNNPSVFRDLSKPIGVVNDKNAKAMREKYENFEDPMGTIDKFHYGTHYSN
SAGVMHYLIRTEPFTTLHIQLQSGRFDCADRQFHSIPATWQALMDNPYDVKELIPEFFYF
PEFLENQNQFNLGCLQVSKEVVNDVILPKWAKSAEDFIYKHRKALESEYVSAHLHEWIDL
IFGYKQRGPAAVEALNVFYYCSYEGAVDLDALTDEKERKALEGMINNFGQTPCQLLKEPH
PPRLSAEEAVQRQTKTDTSTLNLFQHLSELKSFFIEGISDGVPLIKAIVPKNQSRSFMSQ
GSPELLVTVSMNYVLGTHGWLPYDRNISNYFTFIKDQTVTNPKTQRSMNGPFAPGLEITS
KLFIVSHDAKLLFSAGHWDNSIQVMSLTKGKVISHNIRHMDIVTCLATDYCGIHLISGSR
DTTCMIWQITQQGGVPVGLASKPFHILYGHTDEVLSVGISTELDMAVSGSRDGTVIIHTI
QKGQYMRTLRPPCESSLLLTVPNLAISWEGHIVIYSCTEEKTSLKDKNALHLFSVNGKYL
GSQVLTEQVSDICITGEHIITGSLQGFLSIRDLHSLNLSMNPLAMRMPIHCVCVTKEYSH
ILVGLEDGKLIVVGVGKPAEMRSGQLSRKLWGSSKRLSQISAGETEYNTQDSK
Download sequence
Identical sequences F1PLR7
ENSCAFP00000018744 ENSCAFP00000018753 XP_545603.3.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]