SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018837 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018837
Domain Number 1 Region: 385-599
Classification Level Classification E-value
Superfamily VPS9 domain 4.05e-36
Family VPS9 domain 0.001
Further Details:      
 
Domain Number 2 Region: 52-162
Classification Level Classification E-value
Superfamily SH2 domain 9.83e-17
Family SH2 domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018837   Gene: ENSCAFG00000012803   Transcript: ENSCAFT00000020304
Sequence length 785
Comment pep:known_by_projection chromosome:CanFam3.1:18:50975814:50982107:1 gene:ENSCAFG00000012803 transcript:ENSCAFT00000020304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METPGEPGAGPLGAPSLSNFTPGHPEREKPAQDPLYDVPGAGGWQTVGPQRPGRTVSLRE
RLLLTRPVWLQLRASAAAALHVLRTEPPGMFLVRKSNTRGCQALCVRLPEASGPSFVSSH
YIQESPGGVSLEGSELMFPDLVQLICAYCHTRDILLLPLQLPRAICQAATHKELEAISHL
GIEFWSSSLNTRAQQGPSEDQLLPRLKPRPPQELDQGTGATLCFNPLFPEDLGPTSGEKF
RGSFKVRVSTETSSPLSPPAVPPPPVPILPGAAPSETDRLPPRQLLRRESSVGYCVPGGA
SPSLPPLPSLREVDCGSPSSSEEEGAPRAHGSPATSPRLGHRRPLLRSMSAAFCSLLVPE
RQVGRVATALMQDRQTAVGQLVQDLLTQVRAGPEPRELQDVREALSRARAMLSTELGPEK
LLPPERLEHILEKSLHRSVLKPLRPILASRLRHRLSANGSLGRLAEGLRLARAQGPGAFG
SHVSLPSPVEMEQVHQKLLQLLHAYSPSAQVKRLLQACQLLYTALRTQAGEGAGADEFLP
LLSLVLAQCDLPELLLEAEYMSELLEPTLLTGEGGYYLTSLSASLALLSGLDQAHTVPLS
PSQELQRSLSLWEQRRLPATHSFQHLLRVAYQDPSSGCTSKTLAVPPGASIATLSQLCAT
KFRVTQPDTFRLFLYKEQGYHCLPPGALAHRLPTTSYLVYRRAEQPEAQEATPRATPEAS
SGQPEAGDREEAGGRQGDGAFKVKASPEDSRGESETITERAEGGMGQAREGPAQPGGPEA
EAAEE
Download sequence
Identical sequences E2RGE1
ENSCAFP00000018837 ENSCAFP00000018837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]